Conserved Protein Domain Family
K167R

?
pfam08065: K167R 
K167R (NUC007) repeat
This family represents the K167/Chmadrin repeat. The function of this repeat is unknown.
Statistics
?
PSSM-Id: 311832
View PSSM: pfam08065
Aligned: 171 rows
Threshold Bit Score: 69.1221
Threshold Setting Gi: 0
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118572663   2458 KIT-EVSCKSPQPESFKTSRSSKQRLKIPLVKVDMKEEPL-AVSKLTRTSGETTQThtepTGDSKSIKAFKESPKQILDP 2535
88_pfamImport     1 GTTtKMPRKSSQPEPIHSSTSRKRQLKTPQRKVDVKEEVP-ALRKHSKISEEYTHI----VGDDKSMEVFKETPKQKLDP 75
127_pfamImport    1 RAA-KTLRQSSRPELGIRAASKKRQGKAPTREEDVEEEEPaAPRKSTRTSGKTTRShraaVGGNKKASVSQETVAQRLGP 79
76_pfamImport     1 KRT-SVSLKSPQPVLVRTTQTSERLAKTSLGKVGVREEIS--LNMPRCAAGESVHIpslpEDDGRGKKDLKKSRTQTLGP 77
30_pfamImport     1 ESA-KISLESSQAEPVRTRASTKRLSKTGLNKMDVREGHS-PLSKSSCASQKVMQTltlgEDHGRETKDGKVLLAQKLEP 78
77_pfamImport     1 KTA-KVSLESVQAEPVRTPVSTKRLSKTGLDKVDAREKHS-LLSKPRCSSQEVMRVsrlsEDDGSGTKDLKESAAQALDP 78
6_pfamImport      1 IAT-RMSCKSPQPEEKKTLVGLKKQLRIQLFKVGVEEEPT-AQRK--QPARETRSRlkepMGNRINVEELKKSTEQKIDP 76
38_pfamImport     1 TAK-RISSKSPQPEEKETLAGLKRQLRIQLINDGVKEEPT-AQRK--QPSRETRNTlkepVGDSINVEEVKKSTKQKIDP 76
7_pfamImport      1 KTT-KVPSKSPEPVDTTSEIKPRRRLK----RLGVTEEPI-PQRTTTRVLRQTRNThkepIDSSNGVDEFKESSAQKQDP 74
86_pfamImport     1 KTT-KMLSKSPESMDTTSQTQPGRRLR----RVGVTKEPI-AQRKTTRVLRGTRNTpkepVGDSKDVKEFKDSS-QKQGP 73
                            90       100       110
                    ....*....|....*....|....*....|....
gi 118572663   2536 AASVTGSRRQLRTRKeKARALEDLVDFKELFSAP 2569
88_pfamImport    76 GVYATEMKRWSRTPK-KSQPLEDLAGIKELIQTP 108
127_pfamImport   80 AGNAVGSRRRLRTRTeQPPPPEDRPGCQELIAAP 113
76_pfamImport    78 SASVTRSKKQQGSHKeRSQSPEDLFGLQELFQTP 111
30_pfamImport    79 AIYVTRGKRQQRSCKkRSQSPEDLSGVQEVFQTS 112
77_pfamImport    79 AISVTRSKRQRGACKkRSQSPEDLFGLQELFQTP 112
6_pfamImport     77 VASMTVSKRPRRIPKeKAQTVE-LAGLKGPIQTL 109
38_pfamImport    77 VASVPVSKRPRRVPKeKAQALE-LAGLKGPIQTL 109
7_pfamImport     75 AISLTGRRNQPRKVKeKTQPLEELTSFQEEIATR 108
86_pfamImport    74 TVSLTGKRSQSRTLKeKTQPLEELPSIQEETATR 107
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap