Conserved Protein Domain Family
DTHCT

?
pfam08070: DTHCT 
DTHCT (NUC029) region
The DTCHT region is the C-terminal part of DNA gyrases B / topoisomerase IV / HATPase proteins. This region is composed of quite low complexity sequence.
Statistics
?
PSSM-Id: 311837
View PSSM: pfam08070
Aligned: 24 rows
Threshold Bit Score: 40.1169
Threshold Setting Gi: 260807655
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 13959709  1435 RAAPKGTKR------DPALNSG---VSQ--KPDPAK----TKNRRKRK-P-S-TSDDSDSNFEKIVSK----AVTS-KKS 1491
gi 410911494 1491 pPAPKQTKKpdksiwDSDSDTE---DKK--PSAALK----GTGKGRGR-KrKgSDSEEDYSPMKKMNK----PAAR-KPQ 1555
gi 973138283 1499 pkkppkpkkaetivwDSDSEFG---TPK--KTATPK----GKGRGRKRkMsG-SEDEDEYNPVKKTGR----SSAN-KKS 1563
gi 432882842 1486 kipaakakkpdksiwDSDSDTG---SKK--SAATPK----GKGRGR-K-RkG-SGSEDEYTPMKKAVK----PPGR-KPQ 1548
gi 542246177 1492 ppAPK-AKKpdksiwDSDSDTG---SKK--PAPALKg--kGR-GRKRK-GsG-S--EDEYSPMKKTAK----PPGR-KPQ 1553
gi 657565540 1498 ppAPK-AKKpdksiwDSDSDTG---SKKpsPA--LKg--kGR-GRKRK-GsG-S--EDEYSPMKKAAK----PVGR-Kpq 1559
gi 551506017 1487 pAAPK-AKKpdksiwDSDSDTGdtsTKK--PAPALKg--kVR-GKKRK-GsG-S--EDEYSPMKKAPK----PVGK-KPQ 1551
gi 597733954  992 KPTP--TKKldtsvwDSDSDTG---AKK--TPASGKgagkGR-GRKRK-PsG-SE-EDEYSPMKKTGKtpssSSSRqKQK 1060
gi 260807655 1075 KPAPKRKKAm----sDSDSDAP---AAKpkKAAAKK-------PAKKK-AfD-DFISDESDDSAKPKK----APKK-KSK 1133
gi 780171642 1277 KVAPKRKKMal--ssDDESDEV---PAK--KPAASKt---AKKAVKSS-TtT-SDSDDAFKPKKKTAAkkpaKPKA-KPK 1343
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*....
gi 13959709  1492 K-----GESDD-FHM--DF---D------SAVAPRAKSVR--AKKPIKY 1521
gi 410911494 1556 Kp----PSDEEdND---SNgpsL------LKAASRDRPGR--AKKEVKY 1589
gi 973138283 1564 Kk----AASEEeDFD--TNnfgR------SETSSRERPGR--AKKEVKY 1598
gi 432882842 1549 Kp-----PSDDdDDD--SNglsA------ASAFSRGRQGS--ARKEVKY 1582
gi 542246177 1554 Kp---pSDDEDdsns-----------msgLSAPTRDRPGR--AKKEVKY 1586
gi 657565540 1560 kppsededddsnslsamsapsrdrpgrakkevkyfhesdneeddddddm 1608
gi 551506017 1552 Kp---pSDDEDeDDD-------EdnslstAKGPSRERPGR--ARKEVKY 1588
gi 597733954 1061 Kp---vSDEDEdEVDssr---------fsRLDTSRDRSGR--AKKEVKY 1095
gi 260807655 1134 Ka---aYSDEDdDSFape--------dfeAPVAPRARSGRnaASKATKY 1171
gi 780171642 1344 KkaldwSDDDDdASFriHD---Dssd-dvVPPPKRERAGR--AKATVKY 1386
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap