Conserved Protein Domain Family
NOPS

?
pfam08075: NOPS 
Click on image for an interactive view with Cn3D
NOPS (NUC059) domain
This domain is found at the C-terminus of NONA and PSP1 proteins adjacent to 1 or 2 pfam00076 domains.
Statistics
?
PSSM-Id: 311842
View PSSM: pfam08075
Aligned: 44 rows
Threshold Bit Score: 75.2746
Threshold Setting Gi: 313240136
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|...
3SDE_A        170 PVIVEPMEQFDDEDGLPEKLMQKT-QQYHKEREQPPRFAQPGTFEFEYASRWK 221
1_pfamImport    1 PISVEQYEQEDDEDGLVEKSVERQ-TGYQKEREVPPHFATPGTFESEWAQRWK 52
19_pfamImport   1 -VVASTLEQEDTEDGLMERNVSKS-QSYFQEREAPPRFAKPNSFEEEFARRWK 51
gi 954485075  214 PIVVEPFEVKDDEDGLAERLMTKN-ASFQRERTAPPRFAPPGTFEFEYGNRWK 265
gi 260790499  168 PILVEPLEQKDEEDGLQEKHIARN-ANYTREREVQPRFINPSTFEFDMSQRWK 219
gi 675861618  230 PIEVEFLEQKDENDGLPELFFTKT-SELLKDREKPPRFVQPGSFESDIGQKWK 281
gi 762072372  288 PISAENLEAKDEDDGLSEKFLPRN-QQYQAEREKEPRFAPPGSFEYRFGLKYR 339
gi 196005557  159 PVTVRSLEAEDDEDGLPERVVRNN-AAYQKEWSVSPRIVKRNSREWEFIQRWK 210
gi 340382048  226 PVVVSELVRENEDDGLAERDINKS-AQYHYERDSIPRMAVPGTPEFDFGMRFK 277
gi 241044157  190 PIWAEPLEYRDWVLGLPERSVSRRgRGYAREREVGPRFARPGTQEHRVAERWK 242
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap