3SDE,5CA5


Conserved Protein Domain Family
NOPS

?
pfam08075: NOPS 
Click on image for an interactive view with Cn3D
NOPS (NUC059) domain
This domain is found at the C-terminus of NONA and PSP1 proteins adjacent to 1 or 2 pfam00076 domains.
Statistics
?
PSSM-Id: 336918
View PSSM: pfam08075
Aligned: 41 rows
Threshold Bit Score: 76.4318
Threshold Setting Gi: 313240136
Created: 28-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|...
3SDE_A        170 PVIVEPMEQFDDEDGLPEKLMQKT-QQYHKEREQPPRFAQPGTFEFEYASRWK 221
gi 260790499  168 PILVEPLEQKDEEDGLQEKHIARN-ANYTREREVQPRFINPSTFEFDMSQRWK 219
gi 675861618  230 PIEVEFLEQKDENDGLPELFFTKT-SELLKDREKPPRFVQPGSFESDIGQKWK 281
gi 196005557  159 PVTVRSLEAEDDEDGLPERVVRNN-AAYQKEWSVSPRIVKRNSREWEFIQRWK 210
gi 1133475355 226 PVVVSELVRENEDDGLAERDINKS-AQYHYERDSIPRMAVPGTPEFDFGMRFK 277
gi 313240136  264 aVVCAAVDSVDDADGLQEECLYNT-YGFEEEYSFPPRFAAQETFEMDFGNRWK 315
gi 1087826149 269 aVVASTLEQEDTEDGLMERNVSKS-QSYFQEREAPPRFAKPNSFEEEFARRWK 320
gi 241044157  190 PIWAEPLEYRDWVLGLPERSVSRRgRGYAREREVGPRFARPGTQEHRVAERWK 242
gi 156377944  156 PISVEQYEQEDDEDGLVEKSVERQ-TGYQKEREVPPHFATPGTFESEWAQRWK 207
gi 780097148  254 PVTVEPLEQKDEEDGNQERYIMKN-REYQREREQPPRFAQPGSFEYEWGQRMK 305
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap