Conserved Protein Domain Family
Enterotoxin_HS1

?
pfam08090: Enterotoxin_HS1 
Heat stable E.coli enterotoxin 1
Heat-stable toxin 1 of entero-aggregative E.coli (EAST1) is a small toxin. It is not, however, solely associated with entero-aggregative E.coli but also with many other diarrhoaeic E. coli families. Some studies have established the role of EAST1 in some human outbreaks of diarrhoea. Isolates from farm animals have been shown to carry the astA gene coding for EAST1. However, the relation between the presence of EAST1 and disease is not conclusive.
Statistics
?
PSSM-Id: 116695
View PSSM: pfam08090
Aligned: 2 rows
Threshold Bit Score: 46.3119
Threshold Setting Gi: 75346101
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30
               ....*....|....*....|....*....|....*.
gi 75346101  3 STQYIRRPASSYASCIWCTTACASCHGRTTKPSLAT 38
gi 75365599  1 SIRCIRKPASSCASCIWCVTACGSSPGRTTKPSPAT 36
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap