Conserved Protein Domain Family
Antimicrobial_7

?
pfam08102: Antimicrobial_7 
Scorpion antimicrobial peptide
This family consists of antimicrobial peptides secreted by scorpions. Novel antimicrobial peptides have been isolated from scorpions, namely the opistoporin and the pandinin. These peptides form essentially helical structures and demonstrate high antimicrobial activity against Gram-negative and Gram-positive bacteria respectively.
Statistics
?
PSSM-Id: 116704
View PSSM: pfam08102
Aligned: 4 rows
Threshold Bit Score: 48.06
Threshold Setting Gi: 12585254
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40
               ....*....|....*....|....*....|....*....|...
gi 74845608  1 GKVWDWIKKTAKDVLNSDVAKQLKNKALNAAKNFVAEKIGATP 43
gi 25453143  1 GKVWDWIKSAAKKIWSSEPVSQLKGQVLNAAKNYVAEKIGATP 43
gi 28201848  1 GKVWDWIKSTAKKLWNSEPVKELKNTALNAAKNFVAEKIGATP 43
gi 12585254  1 G-ILDTIKSIASKVWNSKTVQDLKRKGI----NWVANKLGVSP 38
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap