Conserved Protein Domain Family
Antimicrobial12

?
pfam08107: Antimicrobial12 
Pleurocidin family
This family consists of the pleurocidin family of antimicrobial peptides. Pleurocidins are found in the skin mucous secretions of the winter flounder (Pleuronectes americanus) and these peptides exhibit antimicrobial activity against Escherichia coli. Pleurocidin is predicted to assume an amphipathic alpha-helical conformation similar to other linear antimicrobial peptides and may play a role in innate host defense.
Statistics
?
PSSM-Id: 116706
View PSSM: pfam08107
Aligned: 4 rows
Threshold Bit Score: 49.3966
Threshold Setting Gi: 34101171
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40
               ....*....|....*....|....*....|....*....|..
gi 37999867  1 MKCATLFLVLSMVVLMAEPGDAFFHHIFRGIVHVGKTIHRLV 42
gi 48474582  1 MKFTATFLVLSLVVLMAEPGECFLGALIKGAIHGGRFIHGMI 42
gi 82095202  1 MKLAAAFLVLFLVVLMAEPGESFLGFLFHGIRHGIKAIHGMI 42
gi 34101171  1 MRCIALFLVLSLVVLMAEPGEGFIFHIIKGLFHAGKMIHGLV 42
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap