Conserved Protein Domain Family
Toxin_31

?
pfam08119: Toxin_31 
Scorpion acidic alpha-KTx toxin family
This family consists of acidic alpha-KTx short chain scorpion toxins. These toxins named parabutoxins, block voltage-gated K channels and have extremely low pI values. Furthermore, they lack the crucial pore-plugging lysine. In addition, the second important residue of the dyad, the hydrophobic residue (Phe or Tyr) is also missing.
Statistics
?
PSSM-Id: 71554
View PSSM: pfam08119
Aligned: 2 rows
Threshold Bit Score: 48.1786
Threshold Setting Gi: 39932243
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30
               ....*....|....*....|....*....|....*..
gi 39932244  1 DEEPKETCSDEMCVIYCKGEEYSTGVCDGPQKCKCSD 37
gi 39932243  1 DEEPKESCSDEMCVIYCKGEEYSTGVCDGPQKCKCSD 37
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap