Conserved Protein Domain Family
Lyase_8_N

?
pfam08124: Lyase_8_N 
Click on image for an interactive view with Cn3D
Polysaccharide lyase family 8, N terminal alpha-helical domain
This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
Statistics
?
PSSM-Id: 311858
View PSSM: pfam08124
Aligned: 15 rows
Threshold Bit Score: 336.626
Threshold Setting Gi: 14278192
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1N7Q_A         12 WNGII------AGNQyYDSKNDQMAKLNQELEGKVADSLSSISS--QADRIYLWEKFS--------NYKTSANL--TATY 73
gi 81758412    51 WASYF------LGDQ-TMAFDQQLTNEITKINHQAKQWLDQL----TIDENGLWADLPlqtdnaeqKRKLGIQL--YATY 117
gi 81758413    73 WM-------------------QQFQSSRTNVN------------------AGLWLDLPlatateqdKKQLGDQL--YKSY 113
gi 81719888    45 WLVLA------LGAG-YDPTAEPYASRLRRTGELARGYRATM----APAAASLWPGHP---------FDPPSGI--TQSY 102
gi 338810347   46 WIDII------TGRRaARTSDPRARAIIAKTDRKVAEILTDLVSgsSRQTVLISADLR---------KEQSPFI--TKTA 108
gi 81586798    19 WDLVLpcpsicTSALqNDDFDILMKKIRDGVAENPN----------IDKALELYDDVQgcfididyARRDRTNWmpLIHV 88
gi 81585448   241 WRNQL------VSKE-YDSTNQALVDYVQKISNEATELDQTMNK--EPNRSYLWPLEP--------GNTPSADL--TTQF 301
gi 122262487   85 WRDRL------IATK-PDMSDPNVKAYLTDLAAQSQTLWATMDR--SANRSRLWLKKS--------SDTTSADY--TSMF 145
gi 81838818   271 WKMRL------LGTTqYD-NDADVQQYRAQIATESLALWQTLNQ--AADREYLWERKP--------SDTVSADY--TTQF 331
gi 500010840   50 WVDQI------TGRKvLVAGDNDFVTALAALDKKARTAIDLLER--SAGRLTVFSDLS---------LAKDTDL--VTTH 110
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1N7Q_A         74 RKLEEMAKQVTNPSSRYYQDETVVRTVRDSMEWMHKHVYNSEKSIVGNAADYEIGTPRAINNTLSLMKEYFS---DEEIK 150
gi 81758412   118 QRIFTLARAYKLPGGELENDPQLLAMLVESLAFLHDNFYHVGTAEWGNWWHWQLGIGRVANNTLVVLYDELP---QEIIS 194
gi 81758413   114 QRLFTMAQAYQLPKSDLYQSVELLDVITEGLAILNQHFYKVGVEEWGNWWHWQLGISRVANNILVLMYQELP---ASLVT 190
gi 81719888   103 SRLWTMTQAYVQEGTGSTGDAGLLADIVRGLDHVSATVYNPTTTRYGNWWEWQIGSPRLLMDIVAALHDRLS---AARRA 179
gi 338810347  109 RAIESMACAWATPGSSYHKDPEILSACIEGLRDFCRLRYNPSQDEYGNWWDWEDGASRAVADVMCILHDVLP---PEVMS 185
gi 81586798    89 DRLYDFVFAYTHPKNSYYQNEDLYHKIVKGLEYWHHRNPHCN-----NWWYNQIAEPQKLGILLIQMRVGKRqipEVLET 163
gi 81585448   302 TKLQKLALAYGTKGSTLYQDDKLAATIIDGLDFMVTQKGYDGKKYHGNWWDWQIGVPQKFLNILMILEDKVS---PEKQQ 378
gi 122262487  146 TNIKMLTLGYYNPVSQQHQNPEVYQAIIDAIDFMETAKKYNGSYSTGNWWDWQIGSAQQLDDTLILLYNDLHrqdPEKLV 225
gi 81838818   332 TNIKKLALGYYEPSSELFEKPEVYDAIVKGIEFMIDTKKYNGTYYTGNWWDWQIGSAQPLTDTLILLHDDLLntdAEKLN 411
gi 500010840  111 TRLATMATAWATPGSEHFADAGLLAAIRAGLADANSLCYNASKEEQGNWWSWEIGTPKALADTMVLLHAELT---AAERA 187
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1N7Q_A        151 KYTDVIEKFVPDP--------EHFRKTTDN--PFKALGGNLVDMGRVKVIAGLLRKDDQEISSTIRSIEQVFKLVDQGEG 220
gi 81758412   195 NYVDASRYFVPRPthl--segYGAPYSSAPl-MFESTGGNRTDNAQVVLIRGILDNNENEIKSAVESLSSIIPFVTEGDG 271
gi 81758413   191 NYIDAIEYFVPNPthl--segAGASASSMPr-PFESTGANRVQNVQVVLVRALLANDQDAFQTAVDALEPVITFVESGDG 267
gi 81719888   180 AACAAVGHFIPDD-------------MLRDy-SGTSTGANRVDLCRGVALSGILGRAPDRIALARDALSPVFPYVTQGDG 245
gi 338810347  186 AAAAGIDHFIPDPwfq---qpASVKPTANPvqPVVSTGANRMDLTRAVMCRSIATGDEKRLRHAVDGLPDAWRVTTEGDG 262
gi 81586798   164 KVLQRMRKDGGHP--------------------ARWTGANRTDIALHWIYRACLQKNDVDLKTAVENVYSPLSYTVK-EG 222
gi 81585448   379 IYTNALSSYVPDPfkqlytkpQGTFVDLAFipNFVTSGANRTDLALTVLGLGILQKDSGKINQASSSIVDVFKLVTKGDG 458
gi 122262487  226 KFVQPLLGYAKDP-------------NIQWp-AYTATGANLTDISISVLASGLLLEDDKRVALVQQNLPKAMGLVTAKDG 291
gi 81838818   412 KFTAPLMLYAKDP-------------NIQWp-IYRATGANLTDISITVLGTGLLLEDNQRLVQVQEAVPSVLKSVSSGDG 477
gi 500010840  188 AYCAAIDHFVPDP---------WQQFPPKRg-KITSVGANRVDLCQAVTIRSLVDEDAEKLTHAVAGLSEVWQYVSAGNG 257
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1N7Q_A        221 FYQDGSYIDHTNVAYTGAYGNVLIDGLSQLLPVIQKTKNPIDKDKMQTMYHWIDKSFAPLLVNGELMDMSRGRSISRANS 300
gi 81758412   272 FYQDGSFIQHKDLPYSGTYGQVMVEGLGMLMGLVANTPWQANDPNLQKIYPLLLEAFAPLLVDGKMMDMVNGRAISRISG 351
gi 81758413   268 FYSDGSFIQHTDIPYNGSYGNELLEGLGLLLGTIASAPWNEQTEQYSAIYSLLLEAYAPFLVDGRMMDMVNGRAVSRLSG 347
gi 81719888   246 LYADGSFVQHTWVAYSGTYGQVLLDGLGRLFSLFAGSTWDVTDPNRQIILDSVEQAYAPLIHDGLVMDSVNGRAISRGYL 325
gi 338810347  263 FRADGGFIQHSHIPYTGGYGDVLFSGLAMLFPLVSGMRFDIVESARKAFHDQVERGFIPVMYNGQILDDVRGRSISRINE 342
gi 81586798   223 FQHDNSYFQHGVQLYIGGYGDEILKGVTQVALYTKGTKYALDDERIQFLRHFMCGTYYQVIRGQYMLFDVLGRGVSRNNA 302
gi 81585448   459 FYQDGSFIQHNNIPYTGSYGNVLVKGVGQILAITADSSFQMDATLVTEFVENVDRAFLPLIYKGEMLPTVNGRSISRAPA 538
gi 122262487  292 IYADGSFVQHTFFPYNGSYGNEMIKGIARVSSTLVGTPWAISEVQFANVFNLIDKGFLQLMVNGRMPSMLSGRSISRAPG 371
gi 81838818   478 LYPDGSLIQHGYFPYNGSYGNELLKGFGRIQTILQGSDWEMNDPNISNLFNVVDKGYLQLMVNGKMPSMVSGRSISRAPE 557
gi 500010840  258 FFTDGSFIQHSTTPYTGSYGVVLLTGLSKLFALLGGTGAEVSDPSRDILFKTVEGSFAPFMVAGAMADSVRGRSISRESN 337
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|....
1N7Q_A        301 E---------GH-VAAVEVLRGIHRIADMSEGETKQRLQSLVKT 334
gi 81758412   352 Q---------NQ-KVGQAMLSSMLLYLPGAPENYKQQLGEFLKS 385
gi 81758413   348 Q---------NH-KIGHAVLNSMLFFIESAPSNVKKQLQSVIKT 381
gi 81719888   326 KsddlhvmrgDH-FHGQALIAAIALLAGGAGPQERARWHARIKG 368
gi 338810347  343 S---------AA-MHGISIARAMLMMADALPTHRAEQWRGIVHG 376
gi 81586798   303 T---------QK-SHAALFAKRMLEL---APAHID-EYNAIIAR 332
gi 81585448   539 V---------GKtGYGSTTMYNLLIVAKFAPNNYQKKFQEAVKY 573
gi 122262487  372 T------------ECGNHGV------GDWQRDVSQSDLDCRGNA 397
gi 81838818   558 Tnpf----ttEF-ESGKETIANLTLIAKFAPENLRNDIYTSIQT 596
gi 500010840  338 T---------GF-DLGASTIESILLLARAVDPVTARRWRSLCLA 371
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap