Conserved Protein Domain Family
Ribosomal_S22

?
pfam08136: Ribosomal_S22 
30S ribosomal protein subunit S22 family
This family consists of the 30S ribosomal proteins subunit S22 polypeptides. This polypeptide is 47 amino acids in length and has a molecular weight of about 5 kDa. The S22 subunit is a component of the stationary-phase-specific ribosomal protein and is assembled in the ribosomal particles in the stationary phase. This subunit along with other stationary-phase-specific ribosomal proteins result in compositional changes of ribosomes during the stationary phase. The significance of this change is not clear as yet.
Statistics
?
PSSM-Id: 311863
View PSSM: pfam08136
Aligned: 2 rows
Threshold Bit Score: 61.5986
Threshold Setting Gi: 55584094
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....
gi 55584094   1 MKSNRQARHILGLDHKISNQRKIVTEGDKSSVVN--NPTGRKRP 42
gi 970955794  1 MKSNHQARHLLGLNYKLSRQKKVVLEGDEETTINhiHATGRKRR 44
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap