Conserved Protein Domain Family
SspH

?
pfam08141: SspH 
Small acid-soluble spore protein H family
This family consists of the small acid-soluble spore proteins (SASP) of the H type (sspH). SspH are unique to spores of Bacillus subtilis and are expressed only in the forespore compartment during sporulation of this organism. The sspH genes are monocistronic and are recognized by the forespore-specific sigma factor for RNA polymerase - sigma-G. The specific role of this protein is unclear but is thought to play a role in sporulation under conditions different from that of the common laboratory tests of spore properties.
Statistics
?
PSSM-Id: 311866
View PSSM: pfam08141
Aligned: 64 rows
Threshold Bit Score: 57.1614
Threshold Setting Gi: 504779142
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*...
gi 182691585  1 MDKTRAQEIISSPNMISVTYNGKEIYIENVNENTQTANIHLLNKPDKKQEVPLNNLVE 58
gi 524598552  1 MNKKRVYEILKSKEKYDVFYDNRPVWIQEV-ENNNIAKVGFIDGPD-EKDVYLKDLYE 56
gi 524722298  1 MELNRVKSILNNDEKFDIFYNSRPVWIQGINTSSNIAKVGFVD-TFEEKDVSISDLNE 57
gi 524607922  1 MNKQRLNEILNHRQLSEVFYEEKPVWIQEVNDD--IAKIGFLDGS-PEKSVYIDDLYE 55
gi 524267384  1 MEIKRIYEILNNKEKVEVEYNSRPVWIQNL-EDSDTARVGFIDN-FDEMEVNIRDLIE 56
gi 524464579  1 MNLERINSILNNKEKCDVFYDNRAVWIQGIS--NTTAKVGFIDN-FEEKDVEIQDLYE 55
gi 524252584  1 MNNKRVSEILKNKKLHDVYYDDRPVWIQEID--NNIAKVGFIDN-NEERNVYIEDLYE 55
gi 524299110  1 MTNKRVCEILKNKDIKEIYYNDQPVWIQEVH--GNKATVGFV-GSNDTKDLYIKELYE 55
gi 524146194  1 MTNKRISEILQGKEIKEIYYNEQPVWVQELH--GNTAKVGFL-NSDSTKDLYIDDLYE 55
gi 524702764  1 MKASKIHEILRNKQKVDIFYNERPVWIQEVN--NDIAKIGFIDN-FEEKNVHIEDLYE 55
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap