4U7A


Conserved Protein Domain Family
BOP1NT

?
pfam08145: BOP1NT 
Click on image for an interactive view with Cn3D
BOP1NT (NUC169) domain
This N terminal domain is found in BOP1-like WD40 proteins.
Statistics
?
PSSM-Id: 311870
View PSSM: pfam08145
Aligned: 112 rows
Threshold Bit Score: 234.331
Threshold Setting Gi: 0
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4U7A_A        184 YDEMPHIGYDINGKRIMRpAKG---SALDQLLDSIELPEGWTGLLDKNSGSSLNLTKEELELISKIQRNEQTDDS---IN 257
gi 122071541   75 YENYKHMGYDADMKKVTKrIQD---DKIDEFIKKAEDPNWWRTIQDELNQREIVLTDEQLKLLERIRKGKFASKAi-aSN 150
82_pfamImport   1 YEKYDHIGYDRDGQRIVKqLSS---SAVDRLLAQ-DDPEGWRTIVDVKNNKKYRLTDTDLEIIRRIRSGAFPAPT---HD 73
8_pfamImport    1 YDEFDHQGYTIDGERLCKiFGKs-dSELQSLVDST-NPDAWRTILDIKNQKTTKLTDEDLEIIQRVLSHQYVNPN---FD 75
gi 74951418    84 YETEDHIGYTVEGKKLIKeLDS---TQLGQLIFNSENPDAWRTIIDPRNNRTIRLTDDDLKIIRRIRKGLYPSET---YD 157
4_pfamImport    1 YEREEHIGYTIDGEKLIKeLDS---TELGKLIFKSENPDAWRTIVDVRNNRTVRLSDDDLKLISRIRKGMYPQEN---YD 74
18_pfamImport   1 -DNHDHIGYDISGKKIARtVKT---SEIDTLLRAAEDPDAWRTVTDIKNDREIKLSDTDLRIIQRIRKGFFPTGRgdgDE 76
1_pfamImport    1 YEDEEHVGYDIAGNKIDQ-VMKlkeSEIDNLLRYADDPDAWRTVVDAKNQTEYRISDAELEIIRRLKEGRLGLTE---LN 76
gi 75016066   185 YEDFDIIGYDIEGKKIYK-SDE---NLIDDFLNSQRDENHWRKIKDVKNNRVVQLTDADLQIIKSIRENKVATI----LN 256
3_pfamImport    1 YEDLDIVGYDIWGNKIQK-KDE---NAIDDFLESKRDQNAWKKIKDKKNNRVVELTNQDLEIIRSIRQGKVAKR----MN 72
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4U7A_A        258 PYEPLIDWFTR-HEEVMPLTAVP-EPKRRFVPSKNEAKRVMKIVRAIREGRII--------PPKKLKEM----------K 317
gi 122071541  151 DYTVEYEY-----DGTMPLSSAP-IPKRRFMPSKNERIKVNKLVQAIQLGRIDpkkyledqEKEEEQE-----------E 213
82_pfamImport  74 DEEVLIESDLE--DSIFPMHNKP-VPKSRFLPSKHEQKKITHLVHQIRSGRLLkeaqrqraEASP--------------A 136
8_pfamImport   76 PEGFIVDFDNK-EDKILPVSNRP-IAKRGFVPSKWETKKINHLAKLIRMGILK--------PNKHRE------------E 133
gi 74951418   158 PEAVTVEFDNK--DSIHPVSFEL-PPKNRFLPSKWEAMKVAKLVKLIKSGKIYtseqkrlnELKKLEEL----------E 224
4_pfamImport   75 QEDLYVEFDNE--DAIHPVAYVP-RPKANFMPSKFEAAKIRRLVKLIKSGKLVvkdepdelPEEPPE------------- 138
18_pfamImport  77 DEEFQVEYEDRiEDKIHPMRTRY-LTKKSFMPDQDEARKVKRLIKLIRAGIIKp------kEEKPAKEE----------E 139
1_pfamImport   77 EEDFQVEFEWT--ENQQPLKRHF-SRKGKFLPGEGEEKKIRAILKAIREGRYY--------SRREKHKS----------V 135
gi 75016066   257 DANYIYENDKE--EYKLYPSGIInQKKNEENGSVHERKKISKIMNYL--------------RNKEKYPErykdkkendeD 320
3_pfamImport   73 EENYVYENEKE--EYKLGVKEP---ANRKYKQSAEEKKKIQQLIMHL--------------MDKEKNPEkykke-edefK 132
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4U7A_A        318 EKekienyqYDLWGD----STETND----HVMh-LRAPKLPPPTNEESYNPPEEYLLSPEEKEAWE--NTEYSERERNFI 386
gi 122071541  214 ML-------FDIWEG----TKDQDEiqkkLPPa-ISAPKVKPPGHNESYNPPSEYLMSEKEKKEWQ--NAHPEDREIPFI 279
82_pfamImport 137 AV-------FDLWGTsvyvDRSGGDrrkkGLPvaLPAPKLALPGHAESYNPPEEFLFNDDEKKQWE--AMAPEDRPLSFL 207
8_pfamImport  134 EI-------FDLWGMeiitPEGNNLatskRPAh-IPAPKLEPPSHKFSYNPPEEFLMTPEEISNLQ--EMDDNEK--DII 201
gi 74951418   225 RV-------EDIWKDsiydVDPTSAkrsyKHE--IKPPKIALPTNSESYNPPEEYLLNEEETKEWK--ETPEHERSVNYL 293
4_pfamImport  139 ----------DIWGDciyqYDPKTArrgrHEE--ITAPKAPLPTHSESYNPPEEYLFDDKEKEEWL--ETDPEERKIDYL 204
18_pfamImport 140 EV-------FDAWGDe---DEEGEGrklkGPAp-IPAPKQALPTHSESYNPPDEYLFDDAEKAEWE--AGDDSIRKQNYM 206
1_pfamImport  136 DP-------FDVWGEnitvAYDKKGrplkPI---LPAPKLPPPGHAESYNPSPEYLFDEEEKRQWE--EAHPDDKKYDFI 203
gi 75016066   321 YI-------YDLWNNriydEFNNINe--------ISLPHI-LPGHKYSYNPPPELMLSSSEKRKLLknNKDA------FI 378
3_pfamImport  133 LL-------YDLWKHkiydDFNNVNe--------MNLPNI-LPGHKYSYNPPPELMYNSADRRKILkqNSDA------FI 190
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....*....
4U7A_A        387 PQKYSALRKVPGYGESIRERFERSLDLYLAPRVRKNKLNIDPNSLIPELPSPKDLRPFP 445
gi 122071541  280 PKKYDCLRHVEFYQGLITERFERQLDLYLCPRIRKKKLDIDPETLVPSIPKPQELRPYP 338
82_pfamImport 208 PQRHSALRLVGAYKDLILERFNRCLDLYLCPRSLKMAMNVDPESLLPQLPSPNELRPFP 266
8_pfamImport  202 PQKYDCLRRVPGYSNLILERFERCLDLYLCPRTIKLRMNVDPESILPPTIDTSCLKPYP 260
gi 74951418   294 PTQYSSMRLVPVYPNLIVERFNRCLQLLMCPRAVKLKMNVDPESLLPKLPSPSELGPYP 352
4_pfamImport  205 PQQHECLRRVGSYQNLILERFRRCLQLYLCPRAVKLKMNVDPESLYPKLPDIDSLRPFP 263
18_pfamImport 207 PQKFACLRHVPFYRDFLKERFERCLDLYLCPRVVKKKMNVDPLSLLPQLPSPSDLRPFP 265
1_pfamImport  204 PTAHKSLRQVPGYAELVKEKFKRCLDLYLCPRSMRLNWIENSDDLLPELPSLDNFKPFP 262
gi 75016066   379 PQNFKNIRNIEYYKKTYFDLYQRCLDIYLCSRTLKNVLHINKEDLLPKLPSKKSLKPYP 437
3_pfamImport  191 PQNFEKIRNIEFYKKTYFELYQRCLDIYLCSRSLKNVLHIKKEDLLPKLPSTQSLKPYP 249
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap