3J65


Conserved Protein Domain Family
NOGCT

?
pfam08155: NOGCT 
Click on image for an interactive view with Cn3D
NOGCT (NUC087) domain
This C terminal domain is found in the NOG subfamily of nucleolar GTP-binding proteins.
Statistics
?
PSSM-Id: 336938
View PSSM: pfam08155
Aligned: 111 rows
Threshold Bit Score: 77.8691
Threshold Setting Gi: 674591941
Created: 20-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|...
3J65_o         397 KLARDIEAENGGAGVFNVNLKDKYLLEDDEWKNDIMPEILDGKNVYDFLDPEI 449
gi 146097939   398 KTERDYEWENGGPGQYQRNERKTWDLENPEWVDDIIPDIMDGHNIYDNIDPDI 450
gi 762118026   397 KSLRDLEIEEGD--EYTVDLRKHWNLPNEEEKYDIIPEIWQGHNVADFIDPDI 447
gi 514696676   420 KLARDLQEEL--REEYSVDLRKEWDLEDASWRYDEIPEILDGKNVADFVDPDI 470
gi 576695165   447 MTMRDRELAEGD--DFYLNLRDHWLLKNPHERNDIIPEIVDGHNIADFFDPDI 497
gi 167534804   430 KLLRDVQDELG--PEYSTDMRAEWDLKDNSWRYDAIPEIVDGKNVADFIDPDI 480
gi 470306845   392 RTLKDIQQELG--ADYNTDFNSEWTLANPDWQYDKIPEIMDGKNIADFIDPNI 442
gi 358255419   448 PLMRERELAAGDDP-FIINLREHWRIARPEQANDIIPEIMDGYNLIDFFDADI 499
gi 1084309983  423 RTMRDREPDADPDEGFILNLREHWRIKCPEEANDIVPEILNGHNLIDLFDPEI 475
gi 674591941   137 MTLRERELAEGD--EFYLNLRDEWLLKNPKERNDIILEIIEGHNVFDYFDPDI 187
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap