Conserved Protein Domain Family
NOGCT

?
pfam08155: NOGCT 
Click on image for an interactive view with Cn3D
NOGCT (NUC087) domain
This C terminal domain is found in the NOG subfamily of nucleolar GTP-binding proteins.
Statistics
?
PSSM-Id: 311880
View PSSM: pfam08155
Aligned: 111 rows
Threshold Bit Score: 77.8778
Threshold Setting Gi: 674591941
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|...
3J65_o        397 KLARDIEAENGGAGVFNVNLKDKYLLEDDEWKNDIMPEILDGKNVYDFLDPEI 449
gi 762118026  397 KSLRDLEIEEGD--EYTVDLRKHWNLPNEEEKYDIIPEIWQGHNVADFIDPDI 447
gi 576695165  447 MTMRDRELAEGD--DFYLNLRDHWLLKNPHERNDIIPEIVDGHNIADFFDPDI 497
gi 313235142  397 RTERDIELELDD--EYMLDLRKTWDLKNAEEAADAIPEIWEGKNITDFVDPDI 447
gi 358255419  448 PLMRERELAAGDDP-FIINLREHWRIARPEQANDIIPEIMDGYNLIDFFDADI 499
gi 674591941  137 MTLRERELAEGD--EFYLNLRDEWLLKNPKERNDIILEIIEGHNVFDYFDPDI 187
gi 565311026  396 KLEKDLEMEMGD--DYVLDLKKYWDLMNPSEKYDVVPEIWEGHNIADYIDPDI 446
gi 483517828   93 KTERDLELEMGD--DYILDLQKYWDLMNASEKYDKIPEIWQGHNILDYIDPDI 143
gi 431897391   89 KRERDIELELGD--DYVLDLQKYWDILNLSEKHDKIPEIWEGHNVADFIDPDI 139
gi 941766199  396 KLERDLEMELGD--DYVLDLQKYWDLMNEDEKNDKIPEVWEGHNVADYIDPDI 446
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap