Conserved Protein Domain Family
NUC129

?
pfam08157: NUC129 
NUC129 domain
This C terminal domain is found in a novel family of hypothetical nucleolar proteins.
Statistics
?
PSSM-Id: 311882
View PSSM: pfam08157
Aligned: 15 rows
Threshold Bit Score: 104.755
Threshold Setting Gi: 82267072
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 82267072   139 YTVTTVQQCSSACSQQQAAEEFLRSRLYGPGSCRSTCNQLLSLHNKRSRVKGAAVQFVKKDWA 201
gi 556975135  158 YMAVRLKDQGQINLQQERAQDFIQDCLYGPGSNRTTANELFSLSNKKCFNKKAAVQFVDKSWG 220
gi 620978106  128 YTAVRLRDHTLANIQMQEAKAFIQKQLYGPGNSRTTVNQFFSLAQKKLPDKKAAIHFVNETWG 190
gi 47228163   139 YTVTTVQQCSSACSQQQAAEEFLRSRLYGPGSCRSTCNQLLSLHNKRSRVKGAAVQFVKKDWA 201
gi 573893367  156 YKVQRVKDHSLAKAQQTSACDFITSRLYGSGSNRTTTNQLLSLQNKTAKNKRAAVQFIDKQWd 218
gi 941766282  146 YTVSTVTDRGQSDYQRQAAEDFIQSRLYGPGSCRSSNNEMLSLQNKTRADKSAAVQFVKKDWA 208
gi 821465610  151 YVACRLKDQDLIDLRQQAAKGFIQKYLYGRGSNRTTVNKFLSLDNKRLPVKKPAVQFVNNNWG 213
gi 637290542  162 YKAVRLKDESLTNKQQQVAKKFIQRHLYGEGSNRTTANQYFSVENKKSKVKKAAIQFVNNSWG 224
gi 483507885    6 YTAMHLKDQSLTGLHQQTAKDFVYSHLYGPGTNRTSANEFFSLANKKDPVKKAAVQFVDKSWG 68
gi 1020961736  83 YMAVCLKDHSVTGLHQQLAKDFLNAQLYGPHTNRVQANEFFSLANKKAPVKKAAVQFVDKSWG 145
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap