Conserved Protein Domain Family
NUC130_3NT

?
pfam08158: NUC130_3NT 
NUC130/3NT domain
This N terminal domain is found in a novel nucleolar protein family.
Statistics
?
PSSM-Id: 336940
View PSSM: pfam08158
Aligned: 132 rows
Threshold Bit Score: 44.7317
Threshold Setting Gi: 331241994
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|..
gi 74858669   57 YLSHVCVCYPKELSEFPKQISDLLE-NNCN-NLEPELRRILAKSLILMRNRN 106
gi 74832046   58 FVCHVGHCYPKECEDVAEIVLKLLQ-DFKGsTMTSDLRLVLVKSLALLRSKN 108
gi 122113455  58 YICHVCHCYPTESAEVAEVVLRLLQ-EYKGsAMTPELRLALVKSLALLRSKN 108
gi 147732673  99 FLSGLAKHYPKESKQFSDSLFELLR-EQGA-GLDPEVRMAFCKALVLLRNQD 148
gi 802666075  29 FLSGVVIFFKEEAKAFGDQMLTVLR-EQAT-GLDPHVRMAFCKALIPLRNKN 78
gi 313237818  58 FLASTSHCYKEAMKNYGNELAQLIE-TSGH-SFASKLRQDIVKSLMLLRGKK 107
gi 398013622  58 YVCHVGHCFPKDAAVIVNIVLELLRaSKGN-GLPMDLRLALVKSLILLRAKD 108
gi 402592926  61 FLASTSSHYPKESTEYAASIMEILS-SRLT-GLDPEIRVAFCKALVILRNRr 110
gi 674594875  59 FFSQIIHLYPAYAKTFSENVKSALL-SRFF-GMNAHMRMAYLKAFMLLRTRN 108
gi 954343667 105 FLCHSAHFYKDVAHSFAQQLVDTIS-RSAQ-TVQPALRLGICKALLLLHGKr 154
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap