Conserved Protein Domain Family
NUC173

?
pfam08161: NUC173 
NUC173 domain
This is the central domain of of novel family of hypothetical nucleolar proteins.
Statistics
?
PSSM-Id: 336942
View PSSM: pfam08161
Aligned: 134 rows
Threshold Bit Score: 144.186
Threshold Setting Gi: 219110681
Created: 26-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74594579    386 LAKSTKDllSVKYQAAWMEVFNVCAAMFESF--KWQS-SPFLDDIVKTVGELRSNEA-FQGKK-----EADNVLGAAIEA 456
gi 925203375   252 IACILEDllTHKVGTALPHILHLLSAFFKEC--GEHC-AELLTPCLKSVAELRDNTE-FTYKS-----ELENTVGSAIRT 322
gi 321457266   584 ITKSVEQslNYQTVKAWKYVIHLCTTLIEGV--GKSR-PEILKSLIKSLASLRVSPR-FPHEA-----EADFAIGKAVRV 654
gi 754346791   677 IVAEVEKtlQHNLNGAWTYVFPAVGELFIAL--GPRS-SGILGRLLTTIVAMYAPQGrMPYRE-----ALIACAGKAVQA 748
gi 641666532   463 LFNLVTQclSYQYKNACSQVLHTLSTFFKFY--GKCA-PSIFLECIKSLGQLRDSNE-ITFVN-----ELEMTIGAGIKY 533
gi 341892797   455 LLSQLHAvmTMKSASVWKFILRAQMKLYETC--GDGLqGPELTKVLEDLARLRQSDD-CFCKT-----ELDFTIGAAVRH 526
gi 1158596471  455 SVDLCEEalNPRSTGVWQYVLRTETRIFEVC--KGAInhesFARALKTLAALRNDV------NcciipDIDLAIGIAVRH 526
gi 752883444   479 IVSIMHKtlSYQYLEAWRHIFHLIALMFQVI--GKSKlq-eLTDIIRSLGELRDSYN-FAYNS-----DVEYAIGAAIRA 549
gi 751233388   185 VVGTMRKslGYRYLAAWRHVLHLTAVLFQVIstGDLElleeLGSVVETLGELRDFHD-FAYSR-----EAEYAIGAAIRT 258
gi 746834225   477 VVEIMHKtlSYQYIGAWRHVLHLIAVLFQVT--GKLKlq-eLDNVVKTLGNLRDSHD-FAHNR-----DAEYAIGAAIRA 547
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74594579    457 MGPEAVLN--ILPLNLIE-Qk-----AG----QPGRVWFLPILRDSVTNTNLSHFRSEFVPLSEALYQRVMEYAsaEKTV 524
gi 925203375   323 MGPQIVID--TVPFKITP---------Gd--rQFKRSWLLPVFKDNIKNATLKCFVDRFLPLAAVCRNEGDRLKkvNDQI 389
gi 321457266   655 CGPRFLLK--CIPLGITGkE------KNs--yEFPYSWLLPILRENIQNTELGFFIEYFLPLAQTCRARVPQCKedQDRV 724
gi 754346791   749 MGPRRFLN--IVPLGISL-D------APm--aEFPRSWFLPMFKTNIRNTELAYFITAFLPMAERFRQMASTVTneH--- 814
gi 641666532   534 IGPEYIISdkVIPLKVDD-Vg-----------EFKRSWLLPVLKDSISNSTLKCYIDHFLPLALKCREMYENALkaNDKI 601
gi 341892797   527 IGVDHVMN--VLSLDVDP-D------AAilstDFTRSWLLPVLRVNIHNAPISLFISHFLPIAMKIHRRLPSLQaqVQ-- 595
gi 1158596471  527 IGAENVLR--VLPLELDP-Qn-----VSlv-tHFERSWLMPVLRINIRNQSIAFALQYFLPLAYRLRKEAP-----SDVV 592
gi 752883444   550 MGPQVVLN--ILPLRID----------Ddt-iNLKRGWLIPLLKDCITGGTISFFKDVLLPIALTCEEKS------KTGI 610
gi 751233388   259 MGPRAVLN--VLPLELDA-DhqstatAAat-iDLRRSWMIPLLKDCVTGGTIALFNDLLLPIARRCEERAEESKg-ASSA 333
gi 746834225   548 MGPRAVLD--ILPLRID----------Ent-iNLKRSWMIPLLKDCITGGTISFFKDILLPLALRCEEKAK-----GSLA 609
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 74594579    525 EVKIFETLVQQTWAILPGYCELPLDLIESFdQSFAELLSNILYKQTDLRVDICKALQNLVESN 587
gi 925203375   390 GAVSYDLLQSQIWALLPSFSAHPTDISTSF-GSLAKTLGGLLNSRKDLRLIILSTLRKLITHS 451
gi 321457266   725 GFRIFDLLQRQMWALLPGFCKCPTDVEVSF-KQIAKLLGQALADRPDIRMDVMAALRQLIIHS 786
gi 754346791   815 QAKTYDTLCSQVWDLLPGFCTLPTDIPAAF-PRLAEVLGAVIANELELRVPVCNALMTLINTN 876
gi 641666532   602 TAISYDLLESQIWALLASFCSNPSDISTSF-RIIARTMGTMLSSRKELRDTILVSLRKLIASv 663
gi 341892797   596 --RLYSTFQFQLWELLPSFCESPSDLETSF-PDIAPILGAALNERKDLRMTVLNAIRRalrfs 655
gi 1158596471  593 RQKTFVTISDQLWDLLPGLLSSATDFVQNF-PHLAEILSKVLLEQRDLRLIVLSSLRSALRYa 654
gi 752883444   611 EGKTYEFLVPQIWSILPSICNNANDVKDNF-KSIAKLLGMMISDRKDLKLSIMAVLRKLIGKA 672
gi 751233388   334 NQKTYECLVTQIWSILPSICNDASDVKDNF-KLIAQLLGTAINDRRDLRLPAMAALRKLIARA 395
gi 746834225   610 DRKIYECLVTQIWSILPSLCNDASDVKDNF-KSIAKLLGVAINDRRDLRPSAMTALRKLISKA 671
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap