Conserved Protein Domain Family
NUC173

?
pfam08161: NUC173 
NUC173 domain
This is the central domain of of novel family of hypothetical nucleolar proteins.
Statistics
?
PSSM-Id: 311885
View PSSM: pfam08161
Aligned: 135 rows
Threshold Bit Score: 143.792
Threshold Setting Gi: 219110681
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74594579   386 LAKSTKDllSVKYQAAWMEVFNVCAAMFESFKWQS-SPFLDDIVKTVGELRSNEAFQGKK-----EADNVLGAAIEAMGP 459
gi 746834225  477 VVEIMHKtlSYQYIGAWRHVLHLIAVLFQVTGKLK-LQELDNVVKTLGNLRDSHDFAHNR-----DAEYAIGAAIRAMGP 550
gi 321457266  584 ITKSVEQslNYQTVKAWKYVIHLCTTLIEGVGKSR-PEILKSLIKSLASLRVSPRFPHEA-----EADFAIGKAVRVCGP 657
gi 749773530  462 IISQMHKtlSYQYLEAWYHVLHLIALLFQITGRSK-LQGLLNIMQSLGELRDSYNFTHNS-----DVEYAIGAAIRMMGP 535
gi 242023937  458 VFTVVENclKYQFNNAWVQVFTLLGVLYEVIGKDG-EEYIGNSLRTLGNLRESFNFLYVS-----ELDYTIGKAIRSLGP 531
gi 641666532  463 LFNLVTQclSYQYKNACSQVLHTLSTFFKFYGKCA-PSIFLECIKSLGQLRDSNEITFVN-----ELEMTIGAGIKYIGP 536
gi 341892797  455 LLSQLHAvmTMKSASVWKFILRAQMKLYETCGDGLqGPELTKVLEDLARLRQSDDCFCKT-----ELDFTIGAAVRHIGV 529
gi 312079570  455 SVDLCEEalNPRSTGVWQYVLRTETRIFEVCKGAInhesFARALKTLAALRNDV-----NcciipDIDLAIGIAVRHIGA 529
gi 752883444  479 IVSIMHKtlSYQYLEAWRHIFHLIALMFQVIGKSKlq-eLTDIIRSLGELRDSYNFAYNS-----DVEYAIGAAIRAMGP 552
gi 801398147  477 VVEIMHKtlSYQYIGAWRHVLHLIAVLFQVIGKLKlq-eLGNVVKTLGNLRDSHDFAHNR-----DAEYAIGAAIRAMGP 550
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74594579   460 EAVL--NILPLNLI-EQKAG-------Q--PGRVWFLPILRDSVTNTNLSHFRSEFVPLSEALYQRVMEyasaEKTVEVK 527
gi 746834225  551 RAVL--DILPLRID--ENTI-------N--LKRSWMIPLLKDCITGGTISFFKDILLPLALRCEEKAK-----GSLADRK 612
gi 321457266  658 RFLL--KCIPLGIT-GKEKN-------SyeFPYSWLLPILRENIQNTELGFFIEYFLPLAQTCRARVPQckedQDRVGFR 727
gi 749773530  536 DVVL--KVLPLQVD--SSTI-------N--LKRGWLIPLLKDCITCGSISFFTDVLLPIVQICEQKVKK-----EPINGK 597
gi 242023937  532 EMVL--KYIPIVITgEEVNF-------E--FKTCWLLPILKDNIQASSLKFFSEYFLPMALICDKKSKElnerNEKIGGH 600
gi 641666532  537 EYIIsdKVIPLKVD-D--VG-------E--FKRSWLLPVLKDSISNSTLKCYIDHFLPLALKCREMYENalkaNDKITAI 604
gi 341892797  530 DHVM--NVLSLDVD-PDAAIls----tD--FTRSWLLPVLRVNIHNAPISLFISHFLPIAMKIHRRLPSlqaqVQ----R 596
gi 312079570  530 ENVL--RVLPLELD-----PqnvslvtH--FERSWLMPVLRINIRNQSIAFALQYFLPLAYRLRKEAP-----SDVVRQK 595
gi 752883444  553 QVVL--NILPLRIDdd---------tiN--LKRGWLIPLLKDCITGGTISFFKDVLLPIALTCEEKS------KTGIEGK 613
gi 801398147  551 RVVL--DILPLRIDen---------tiN--LKRSWMIPLLKDCITSGTIAFFKDVLLPLALRCEEKAK-----GSLADRK 612
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 74594579   528 IFETLVQQTWAILPGYCELPLDLIESFdQSFAELLSNILYKQTDLRVDICKALQNLVESN 587
gi 746834225  613 IYECLVTQIWSILPSLCNDASDVKDNF-KSIAKLLGVAINDRRDLRPSAMTALRKLISKa 671
gi 321457266  728 IFDLLQRQMWALLPGFCKCPTDVEVSF-KQIAKLLGQALADRPDIRMDVMAALRQLIIHS 786
gi 749773530  598 TYEFLVPQIWSILPSICSDASDVKDNF-KNIAQKLGKTINERKELRLPVLSALRKLIvka 656
gi 242023937  601 SYDLLQLQIWSLLPAFCNGSDDVKENF-KIIARIIGNVIEEKKHVRIHGMAGLRKLITRN 659
gi 641666532  605 SYDLLESQIWALLASFCSNPSDISTSF-RIIARTMGTMLSSRKELRDTILVSLRKLIASv 663
gi 341892797  597 LYSTFQFQLWELLPSFCESPSDLETSF-PDIAPILGAALNERKDLRMTVLNAIRralrfs 655
gi 312079570  596 TFVTISDQLWDLLPGLLSSATDFVQNF-PHLAEILSKVLLEQRDLRLIVLSSLRSALRYa 654
gi 752883444  614 TYEFLVPQIWSILPSICNNANDVKDNF-KSIAKLLGMMISDRKDLKLSIMAVLRKLIGKA 672
gi 801398147  613 MYECLVTQIWSILPSLCNDASDVKDNF-KFIAKLLGAAISDRRDLRPSAMAALRKLISKA 671
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap