Conserved Protein Domain Family
CASP_C

?
pfam08172: CASP_C 
CASP C terminal
This domain is the C-terminal region of the CASP family of proteins. It is a Golgi membrane protein which is thought to have a role in vesicle transport.
Statistics
?
PSSM-Id: 336948
View PSSM: pfam08172
Aligned: 93 rows
Threshold Bit Score: 142.356
Threshold Setting Gi: 552834730
Created: 26-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121936220 443 EALQEELSSANMDLEKSRALNETLEADLEKVQQE--------ASNA-FD---PSGMSVAGTYVSR-YPQSsarrGR--SS 507
gi 630176987 430 QSTQERLSATSSELEKQKSLNEKLENDLLSMNNH--------KTND-TP-----DTSDVLSGL-----DIg--kKT--DS 486
gi 599381318 435 lSVQGELANAEADLERQHMLNEKLENDLLQIQTH--------DRASkTV---IGDNTSATDDVLAgLDLGk--kSG--PS 499
gi 449546374 434 QATKAELEQSEAELEKQRALSEKLENDLLQMDQRkpagdlngGPST-AA---PSDEDDATSDILAgLDLGk--kHS--DS 505
gi 302681481 436 NSVQARLEGTSQELEKQRALNEKLEDDLLALNQG--------GGER-SGrdtPAEGADALAG-LD-IGGKk--aAA--DS 500
gi 443923235 443 QAVSEEVIHTRTELEKQTSLNERLENDLLQINQR--------ASNG-PV---EKE-ETIPSGQEG-LSGLn--lGR--KS 504
gi 299752042 477 KNVENKLDSTSAELAKQKELNEKLENDLLAINNP--------DEKA-NG---SANKSGDDDDIL---ANLd--vGK--KS 537
gi 599383628 444 rknaiEADNLREELEQTKILNDKLENDLVKIQTS--------QDTK-GF---NVDGS-----TTE-SSQDs--kGK---- 499
gi 527304217 436 mAAQAQLVATESELEKQRMLNEKLENDLLQMDQR--------KPNG-EV---GSDSPRLssldgl----agielGKktDT 499
gi 758976476 496 EDALKEIESLEAQVEQAGQLGKASSKPVVQSTPA--------HQAV-AN---GVESASL--------------------- 542
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121936220 508 ---PTSSIisGFDnSPSNtlaslra--gepmggGSGILPMVTAQRDRFKKRNSELEAELQKSHQTVSSLRSEIGALQKDN 582
gi 630176987 487 ---SARSTpiPFTsSA-----------------DTSILPIVTSQRDRFRQRNAELEEELRKQFQIISDLRSEIKSLQSDN 546
gi 599381318 500 ---PARSSpvPFTpSA-----------------DTSILPIVTGQRDRFRQRNAELEEELRKQFNIISELRAEVKSLQQDN 559
gi 449546374 506 ---PARNTpiPFTsAA-----------------DTSILPIVTSQRDRFRQRNAELEEELRKQFNVISELRAEVKSLQADN 565
gi 302681481 501 ---PARGTpiPFAqs----------------saDTSILPIVTSQRDRFRQRNAELEEELRRQFQIITDLRAEIKTLQADN 561
gi 443923235 505 ---TVRVSphSATpQP-----------------DNSILPIVTSQRDRFRQRNAELEEELRKQFESITELRNEIKTLQSDN 564
gi 299752042 538 adnSTRSTpiPFAsSA-----------------DTSILPIVTSQRDRFRQRNAELEEELRKQYQTISELRAEIKSLQADN 600
gi 599383628 500 ------STagPTTsGNDMkl-----------saETSILPIITSQRDRFRQRNSELEEELRKQFDIITSTRNEMKSLQSDN 562
gi 527304217 500 ---LARTTpiPFA-Ss----------------aDTSILPIVTSQRDRFRQRNAELEEELRKQFNIISELRTEVKSLQADN 559
gi 758976476 543 ----ARSVepSAAsRSSVssaapssgggggiggDNSILPIVTSQRDRFRTRNAELEEELRKQFETISELRNEIKTLQADN 618
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121936220 583 LDLYEKTRYVNSYNR-------------TPYSA-----------NANTNPSTVNiaa-----daSDRYKASYESNLSPFA 633
gi 630176987 547 LKLYEKVRYMQSYREeas-------ssrPVTSQ-----------LDPLPAPSGSsd-------dMGKYRARYEEAMNPFE 601
gi 599381318 560 LKLYEKVRYMQSYREda---------ahRSSTL-----------DPIPSNTSGRsd-------dMSKYRTRYEEAMNPFQ 612
gi 449546374 566 LKLYEKVRYMQSYREda---------aaRPSTL-----------DPLPSSSTSRpd-------dMSKYRVRYEEAMNPFQ 618
gi 302681481 562 LKLYEKVRYMQSYREdta-------tsqLNP-L-----------PGSGSASAGGgd-------dMGKWRARYESSINPFE 615
gi 443923235 565 MKLYEKVRYMQSYRDegs-------aswSSVTA-----------QANTd---------------LGKYRTMYEDSLNPFQ 611
gi 299752042 601 LKLYEKVRYMQSYREesa-------gmrPVSQL-----------DPLPGSSRGGgdsgysledgMSKYHSRYEESVNPFE 662
gi 599383628 563 LKLYEKVRYLQSYRDdsvsgs--iitgpSGSRL-----------TNNTLPSAVSrkd-----eeLSKYRGIYEEHMNPFE 624
gi 527304217 560 LKLYEKVRYMQSYREdaavrpstldpipTSAGGrd----------------------------dMSKYRARYEEAMNPFQ 611
gi 758976476 619 LGLYEKVRYLQSYGPagsgatggrgdavIQIGTgngasgrrdasGAYPPPRS------------DDKYRARYEESMNPFE 686
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 121936220 634 AFRGRESARAMKRMHLFERMVLRVTKFVLQTRISRNMFAGYLIALHFIVFYMLFG 688
gi 630176987 602 AFRGREATRAIQNLNPVERGVLVLTRQILGNRRARTFFIFYALALHLLVMFTTYE 656
gi 599381318 613 AFRGREATRAYESLNVLERGVLVLTRAILGNRRTRTAFIVYAIFLHILVMFTTYE 667
gi 449546374 619 AFRGREANRAYESLNVLERGVLVLTRAILGNRRTRTAFICYAIALHLLVMYTTYE 673
gi 302681481 616 AFRGREASRAVQNLNPIERGVLIVTRAVLANRRTRTFFICYALALHVLVMFTTYE 670
gi 443923235 612 AFRGQEAARAAQDLNVIERTVLVITRQVLGNRRARTAFIVYAFFLHGLVLYTTYE 666
gi 299752042 663 AFRGREQTRAYQNLNPLERTVLLLTRPLAGSRRARTLFIFYAIFLHVMLIYKTYt 717
gi 599383628 625 KFRGRERMGALQALNPLDKLVLHVANFVLGNRVARNIFLLYAVILHVLIFMSfse 679
gi 527304217 612 AFRGREATRAYESLNPLERGVLVLTRAILGNRRTRTAFICYAIALHLLVMFTTFE 666
gi 758976476 687 AFRGREQSRAMAQLNPLERALHMLTRLVLSHRRMRLFFMVYAIFLHLLIFGMLLE 741
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap