Conserved Protein Domain Family
PaaX_C

?
pfam08223: PaaX_C 
PaaX-like protein C-terminal domain
This family contains proteins that are similar to the product of the paaX gene of Escherichia coli. This protein is involved in the regulation of expression of a group of proteins known to participate in the metabolism of phenylacetic acid.
Statistics
?
PSSM-Id: 311922
View PSSM: pfam08223
Aligned: 29 rows
Threshold Bit Score: 70.4013
Threshold Setting Gi: 122480084
Created: 23-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81363719  157 GKEEVLRAFPLEEAKAGYGRLSALLGQ--------SP--EDPV------------EAFRHLTRLVHEARKLLFLDPGLPQ 214
gi 121731355 163 PLEIVRKCWDLKEVEEKYKEFVNQWGKvmen-----issLKPN------------EAFITRIRLVHEYRKFLHIDPNLPK 225
gi 74541631  167 PNHLVERCWNLVEVEQAYKSFLEEWSPmlkk-----vnsMKSN------------EAFVTRIELVHEYRKFLNIDPDLPE 229
gi 81380779  166 QEARIRALWDGDALSDTYRTLGAQLEDwlar-apeLDldVAAR------------EAFLLGGKAI---RQVVF-DPLLPE 228
gi 122480084 165 REAVVHQLWNGQALTRTYRQLRAELEAwlar-anqLPldAAAR------------ESFLLGGKAIH---QLVF-DPLLPE 227
gi 81375710  182 PREKVTTWWDLDELTALYTEFLQQYRPvlyr-vtsET--VTAR------------EAFQLYVPMLTQWRRLPYRDPGIPL 246
gi 123046468 185 MGDAATRWWDLDGIAARHRDFLDRHRVals---aaEE--VSPR------------EAFVRFVPLLDEWRIIPYIDPGLPA 247
gi 81720185  172 TFEAVARWWDLAAIAKQHEEFLDRHARvlhdwearED--TEPE------------EAYRDYLLALDSWRHLPYADPGLPA 237
gi 500100612 173 MRPKISEWWDLKELDDQFTEFLELYDGaeqqwaerVG--DDPEvavaesteelrrDAFRYYIPMLTMWRKFPYRDPNLPA 250
gi 500078655 156 fdppptgAWDLAALRLAYEGWLQAADDlveqhlaaHE--DPDE------------AAFAARFHLVHEWRKFLFTDPGLPD 221
                         90       100       110
                 ....*....|....*....|....*....|...
gi 81363719  215 ELLGPDFPGPKVRRLFLSAREELRARAAPFLKG 247
gi 121731355 226 DLLPPNWVGYEAYELFQKLRNKLSTLSDQFFKS 258
gi 74541631  230 DLLPQNWIGYKAYDLFMKLREELTPKANEFFYK 262
gi 81380779  229 PFV-----DVAARAAFIECARRYVGAGHRIWRA 256
gi 122480084 228 PFV-----DTRERHAFIQAVHHFDEAGRAIWNR 255
gi 81375710  247 SLLPPAWQGEAAGTLFDQLNEVLNPLAHKHALA 279
gi 123046468 248 GMLPEDWPGADSVRLFASARDRYLDGSRDWVRS 280
gi 81720185  238 ALLPEDWPGARSAAVFRALHERLRDAGAAFAAG 270
gi 500100612 251 DYLPPEWHGPAVRRTFQAVHRlaaplaaahahe 283
gi 500078655 222 ALLPRDWPGHAAAELFAGAAGRLKPGADRFVAR 254
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap