Conserved Protein Domain Family
DUF1719

?
pfam08224: DUF1719 
Domain of unknown function (DUF1719)
This is a domain of unknown function. It may have a role in ATPase activation.
Statistics
?
PSSM-Id: 311923
View PSSM: pfam08224
Aligned: 53 rows
Threshold Bit Score: 274.822
Threshold Setting Gi: 122167748
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122167748 133 SYFPKQFVQAVKAMKSyvlSF------L-GMNKQYl--LSCSHVRRFEWFAKKAGKFARDVET--GRTLWHYNFFSSLIR 201
gi 75139035   98 GGFTKRIFRAVKSSIS---SL------I-GMDKDEa-sYSDDAVRRFEWFADKAGKFVRDVET--GCSLAHYRFFSPLIK 164
gi 944079577 112 SFFPRRIALVARSCIS---SLgnyyctI-RNGGSEasaGSTAAVRRFERLADSAVEFIRFVELagGSRPRQRMFMDPLIR 187
gi 514812071 103 HSFSKWIAHVTQSSVS---SY------FtGFCKDN---ISCSDVRRNEWFAECANRFLRDVES--GCSPLRCVFSNPLVR 168
gi 944258051  84 lqqegqeigrvcrglnlslSL------I-GLKKDEspcLSCSDVKRFEWFADCASKFVRDMES--GCSLRQYTFCNPLVR 154
gi 960467154 103 SSFPRRIAHTTKAFIS---SF------V-GRNNDHl-sEHIAVVRRFERFADGATEFMRFVQF--SGTPRQHMFFNPLIG 169
gi 721647854 103 SSFPRRIAHTTKAFIS---SF------V-GRDNDHc-sDNIAAVRKFERFADGATEFMRFVQF--GGTPRQHLFFDPLIG 169
gi 473788562 103 SSLPRRIAHTTKTFIS---SF------V-GRKNDHc-sDNITSVRRFERFADGATEFIRFVQL--GGTPRHHMFFDPLIR 169
gi 721647848 103 SSFPRRIAHTTKAIIS---SF------L-SRNNDHc-sYNISDVRRFERFADGATEFMRFVQL--GGTPRHPLFFDPLVG 169
gi 474404457  91 rsLRRKIMHAV---LP---SF------I-VPNQDA---LSSSVVGRFEQFVKEADRFVRDVES--GSSLSHYRFLSSPIR 152
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122167748 202 PLLEGKHLKYDMp-LQ-GSKTL-GITIVPVSLEGRGVEALIQLNKEDSRMPLKNFCLLLILRLSESTDIVRIIINCLQLL 278
gi 75139035  165 HLLEGKRLCYEL--VQ-RSQTL-RLEIDPVRSKERGVEAEIRLCNDNVTMLTRSFNLRLILRLSESTDIVGIIISCLQSF 240
gi 944079577 188 HLLAGREINYELgsPR-GSSHRqFFGIRPISFEERGVEAKLCYDYQDHKAREKSFRLGTMLRLSESTDIIGTIINCLQLV 266
gi 514812071 169 QLLEGKTLEYKM--VQ-GSILR-CLHIQSMCVEGRGVEATLEFRYEDRKTPMRSFSLKLMLRLSESTDIIGTAIRCLQSF 244
gi 944258051 155 HLLQGKMLEYEV--VQ-RDLLR-RFHIWPISLEERGVEAELAYRYDDRKMPHKSFQLRLMLRLSESTDIIGIAIECLQSL 230
gi 960467154 170 HLFAGKLIRYVA--LRsGGRYH-FFTILPMAFEGRGLEAVLSFVYEDCKVPNNSFCLGFTMRVSESTDIIGTIVKCLRLV 246
gi 721647854 170 HIFAGKSIRYMG--LLpGARHH-FFSLWPIAFEERGLEAMLFYAYEDCKVLENSFALGFMMRVLESTDIIGTTVKCLRLV 246
gi 473788562 170 HIFEGKSIRYMV--LHpGGQYH-FFTIQPIASEERGLEAILCFVYEDCKLPEKSFALKFMMRISESTNLIGTTVKCLQLV 246
gi 721647848 170 HIFAGKFIRYMV--LHpRGGYH-CFAIQPVVSEERGLEVTLYFLYEDCKVFENSFTLGLMMRISESTDIIGTTVKCLGLV 246
gi 474404457 153 HLLEGKGLYYDM--VQ-GSKAF-SLGISTDSVEEYGRVAWLCFHYKDRKAPLKTCRLVVALRLYESTNIVGITAKCLRSL 228
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122167748 279 G---PHFTRLAKDAIGQLAALQHShpqDLEpllal-qavdYHRSFLAF---R--------ATVARPDPFCC-R-EKRLdp 341
gi 75139035  241 G---PHFKSLVENAKNTVAELPTQ---DVLn--------sSARIFFAL---PsdtlyegsATTYRPDPLCC-R-THGHgv 301
gi 944079577 267 TakvPHFKPSAEAAIREITQLPTQ---DFScnkpy-vvsdDTEHW-NY---Hni-----lTEWFRPDPLCC-KdRCGHtw 332
gi 514812071 245 M---SSMKDVTEAAVRELTQLPLQ---DISh--------sHAASCFTI---Kdlc--sydTHLWRPDPLCC-K----Pdg 300
gi 944258051 231 -----ESQHVTRSAMGELTLL--R---DLQfgkd--ishkYALPWVGIqesHtq-----dTWIFRPDPICC-K-SNGQes 291
gi 960467154 247 T---PHFKSTADIVIKEITQIPTQ---DFSclpheigsanAERCWNDM---Ltt-----fVGWYRPDPLCC-Q-GYEHdi 310
gi 721647854 247 T---PHFKSTADVVTKEIMQLPTQ---DFSclplevananVEQYWNDI---Htt-----fAGWFRPDPLCC-Q-GYEHnv 310
gi 473788562 247 T---PHFKSTAEIVIKEIAQLPTQ---DFSclppevmsvnAEHYWNEM---Ntt-----fAVCSRPDPLCC-Q-GYEHki 310
gi 721647848 247 T---PHFKSTADIVIKEITQLPTQ---DFFcsppevtsadAKNHWTEM---Htt-----fSTWFRPDPLCC-Q-GYEHds 310
gi 474404457 229 G---PQFKSLVEDATGELSHLPTQ---DVSy--------fDSVMWECM---Vk------lTTESIPDPFCCiA-NGLSkp 284
                        250       260       270
                 ....*....|....*....|....*....|...
gi 122167748 342 cad-------ntispNLPYDIPEQVIYVRCSSY 367
gi 75139035  302 g------------slELSYRFPEQVSNVHFNGY 322
gi 944079577 333 vps-------segsaEL---FPEPVIELFLQGn 355
gi 514812071 301 cpt-------syipsELSCKFPEQIILIHVVCY 326
gi 944258051 292 f-----------snnIISSTFPEQVIFVAFRCY 313
gi 960467154 311 vpscs----gngnklRLWSIFPEPVCHLFLERr 339
gi 721647854 311 vpscrggesingrklRLSSIFPEPVGLVFLQRH 343
gi 473788562 311 vsscrgdesnsgnklRLSSIFPEPVCKVFLQRH 343
gi 721647848 311 vsscgggesssgnklRLSSIFPEPVCQVSLQRS 343
gi 474404457 285 cas-------niissELTGRFPQEVLFVVFNCc 310
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap