Conserved Protein Domain Family
DASH_Hsk3

?
pfam08227: DASH_Hsk3 
DASH complex subunit Hsk3 like
The DASH complex is a ~10 subunit microtubule-binding complex that is transferred to the kinetochore prior to mitosis. In Saccharomyces cerevisiae DASH forms both rings and spiral structures on microtubules in vitro. This family also includes several higher eukaryotic proteins. However, other DASH subunits do not appear to be conserved in higher eukaryotes.
Statistics
?
PSSM-Id: 311925
View PSSM: pfam08227
Aligned: 43 rows
Threshold Bit Score: 30.2196
Threshold Setting Gi: 410078986
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*.
gi 74592649   42 RQYAQLESKLAELNANLANTKSLLEITAVQARD--MRFLGGYVGAL 85
gi 74684753    9 RHYSALASRIRSLHANLAETEGLLDMMTHQLDA--TAKIGVHCGSQ 52
gi 367003639   7 RQYSRLAEQLSQLQDNLEEATQHLDTMSKQCNTniINQLGKLHASW 52
gi 401838955   7 RQYNQLAHELRELQTNLQETTKQLDVMSKQCNEnlIGQLGKVHGSW 52
gi 156849177   7 RQYARLAEQLELLQHNLLNTTEHLDVMSRQCNNniVDQLGKVSASW 52
gi 302310693   6 RQYARLAAHLKQLRENLDETTAQVEIMANQSNM--ITKLGAVQAST 49
gi 124013749  26 REKNQLILENEALGRNTAQLSEQLERMSIQCDVwrSKFLASRVMAd 71
gi 410078986   7 RQYAYLAQQLQQLQTNLQTTKDEMSVLSSQCNKniVGQLGKINASW 52
gi 403213775   7 RQYTYLANQLQSLQSNLQTTRDELEMLSLQCDKnlVGQLGKINASW 52
gi 254586583   8 RQYAHMAQQLQVLQANLAETSRQLEVMSRQCNKniVGQLGRVHASW 53
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap