Conserved Protein Domain Family
SHR3_chaperone

?
pfam08229: SHR3_chaperone 
ER membrane protein SH3
This family of proteins are membrane localized chaperones that are required for correct plasma membrane localization of amino acid permeases (AAPs). SH3 prevents AAPs proteins from aggregating and assists in their correct folding. In the absence of SH3, AAPs are retained in the ER.
Statistics
?
PSSM-Id: 311926
View PSSM: pfam08229
Aligned: 52 rows
Threshold Bit Score: 167.346
Threshold Setting Gi: 0
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74601587     5 DIVPVGSGLIIGATSFGLGVLYANLPYDVNTLWRQDETGT-AFITSLAHYS-VWGNSPAYVHHIFHSVIGLGFIGAFIKL 82
40_pfamImport   1 --ASFWTYLIVCPTSFILGILFTNWSYDFPLLWTSKRLTPeMIKAIEAHYV-MLYDSPPLIGRVLHAIILIALAAFIAKL 77
7_pfamImport    1 --GSFATFLIIGR------ILFASFPYDFPLLWSPNPITPlHISQIETHLR-FMHAAPPLISRLLHMIIAVGFLGFFTKL 71
gi 74614880    20 GSGSFSTFIIIGPVCFFLGILFAQFPYDFPLLWTSEPVQAtYYDFLETHVK-FLHASPLIISRILNIVIFVGLLGFFMKL 98
13_pfamImport   1 -SSPFGTFLIVGCVCFFLGILFASFPYDYPLLWTSAPVPEaYYAQLETHLR-FIYAAPPLIGRLLTSIILVGFIGFFVKL 78
gi 15214297    14 GLKVAARYGVLMSTSFIFALLFHSSVADVNTLW-SPGPES-AFDAAETYYT-LVAGSHFIVKYTVYTIMGLNMIFHLIQA 90
42_pfamImport   1 -----RTGLIIGTTSFLLGTLAMHWTADHLILWQSPVTYD-SVVTAYTYYQdTMVDMPLVFQRLLHGSGTLVALLIISKA 74
30_pfamImport   1 ------AGIVVCITSFLLGALFTHWIADSLTLWKSPVTDE-HLWTAASYYS-IVTKGPREILYLLFALVILGGSTILWSF 72
38_pfamImport   1 ------VALILCSCFFSYGTYWSDWAFDYYLLWANPSEYPeAITRATFYYA-NQGHIPNILKYVPIANLCIAAAGFVTGL 73
29_pfamImport   1 -------AAVLSSVCFFLGVLFICMNVDYRVLF-TPLTED-VVRDGLEFYT-TFFHSPPAIKALMHAIMGVGIIGLVGKL 70
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74601587    83 YKPSEDAKYFEYGSLFLYMVGVIIYLTNLRIGVNSCLAGDWGE------------------VDMPTG----INVMAASQV 140
40_pfamImport  78 YKPSESNALFDGASLVLFMVAVIVYGSNTIKGMQIIKGGDYGEd-----------------IPQAQS----LQVVAASNT 136
7_pfamImport   72 YRAAESNFLFDGGSLLLYLIAAGVYITNVVTPMNALAEQLEGEggekyavhn-gpltgeveLTREES----LRVLSASHT 146
gi 74614880    99 FRPAESNVLFDGASLILYVIGVGVYTSNIVKGMRTITAGIWDMedfagikhd-gpvsgeviLGREDT----MKVLSASNT 173
13_pfamImport  79 FKASEANVLFDGASLVLYFIGVGVYLTNIVRGLRAVGEGIWDDpdweakangnagegdglvLGKEDS----LKVLSASNT 154
gi 15214297    91 TGAKGDDKLFFYSSTLLYLTALILFIVNVAPSMLVVKLQNYVQ------------------FPRNMH----LSVLAASHV 148
42_pfamImport  75 LGGRESNWLFDGASLFLFGAAGLVYYHKIVPSLATLPPKAPSPgs--------------aaVDARDAvfapLREIATSHT 140
30_pfamImport  73 GDGQAGNLMFDGGSIFLFGMTAVMYVYAVLPNLLTHFENLPPHglkd-----------pfpRTLRQS----TLDLASNNL 137
38_pfamImport  74 LTMTDGNLLFDGASLVLMMFGITTYLSSVKPAITVVSESADVN-------------------EITTS----LKNIAAAHF 130
29_pfamImport  71 VRMDEGAKWFDGSSLAAYIFALSVYLSVGLPASRTIATPVEG-------------------VDTREDqieaLRLLSAGNT 131
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|...
gi 74601587   141 MIGFALFGVLLLQGGL---YYAEW-YDNRLKVkFFEEEERAA-LAAASAKTDN 188
40_pfamImport 137 IMALVLIGVLLLQAGQ---WYAERkEKEELDAmSEGLNNADSpTVSKKELKEK 186
7_pfamImport  147 ILAFVLVGVLVLQAGQ---WYAEKrEREDYAAwVARGEPVEVmDSDEEQEKEE 196
gi 74614880   174 ILAMVLVGVLVLQAGQ---WYAESkEKDDYAK-GDKKEKKNDgQQQQQQQQQP 222
13_pfamImport 155 ILALVLVGVLVLQVGQ---AYAERkEREEIEA-LDKKDKEAAaAAAAGKGGAA 203
gi 15214297   149 LVEFLLAGVILIQLGYvfgYHVQSiQQREYAEdMREQELAEKaKLESESATTQ 201
42_pfamImport 141 VLAVALVGVIILQSGQ---YYSERlEERER---IEEDEARIRrRQRRREQEEK 187
30_pfamImport 138 ICSVALTGVLALQAGR---FWAETpDSDDEEFvLVEAPSAEEqQQQQQQRQQE 187
38_pfamImport 131 IIVLAITGIIGLQITH---YFVMKrSNKDREDgGNQETDQEEdEEDEEEEQEQ 180
29_pfamImport 132 IVIALLGGVLFLQAGE---EYARRtEAKELAR-LAELDKKDRsATATSAAGEN 180
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap