Conserved Protein Domain Family
LNS2

?
pfam08235: LNS2 
LNS2 (Lipin/Ned1/Smp2)
This domain is found in Saccharomyces cerevisiae protein SMP2, proteins with an N-terminal lipin domain (Pfam: PF04571). SMP2 (also known as PAH1) is involved in plasmid maintenance and respiration, and has been identified as a Mg2+-dependent phosphatidate phosphatase (EC:3.1.3.4) that contains a haloacid dehalogenase (HAD)-like domain. Lipin proteins are involved in adipose tissue development and insulin resistance.
Statistics
?
PSSM-Id: 336969
View PSSM: pfam08235
Aligned: 89 rows
Threshold Bit Score: 271.266
Threshold Setting Gi: 124457893
Created: 28-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75029407   507 QSLRLSSE--KLKSLGLVFGANELRFSITTKFQGT-TW-CSCNIYLYKWYEQIVVSDIDGTITK-----------SDVLG 571
gi 74832598   393 RSLVPMEA--DLLKLNLVPGHNRIRYITHSSLRGE-VA-VEANVYLWDSTDRLVISDVDGTITK-----------SDVLG 457
gi 122021472  406 RTLIPTEA--DLRKLNLVEGHNQVRYITHSSLRGE-VA-VDANVYLWDSTDRLVVSDVDGTITK-----------SDLWG 470
gi 290990024  287 HRLRPSKEylELIHSHMTDGRSSISF---IDPNGG-LEpVKAYIFEFSPQDKIIISDIDGTITK-----------SDIMG 351
gi 568015418  350 KSLKPSQQ--ELVDMGLCVGMNDIAFVLRSHDSGElAR-VTAKLYLWPVTAKVVIAQIDGAISS-----------SAATG 415
gi 298712787 1115 KTLRPTSE--QLAALRLRPGCNTIEFVVNVAGQAE-RV-VSARAFLWGSGARVVVSDIENTIARsggggsgrgsfSQVIG 1190
gi 146071649  612 rtIIPVEA--DLWKLHLKEGCNTVRYLARKDKGDI-VS-ISCNIFLWNWTDRLVVSDVDGTITK-----------SDLLG 676
gi 402468048  403 lTLKLSSK--QLERMELKPGKNELQFKIDG---TN-QC-ISTNCYFWENDVKIIISDIDGTITK-----------SDKLG 464
gi 906372932  241 REVYLPDT--YIEKMHLVPGPNKTVYRLS----GT-PIfLTCNIYLWNETDKIIISDIDGTVTK-----------SDIVG 302
gi 313228616  394 KTLTLEHE--DLVKFNLQPGRNKIEFVVASKYQGR-GY-AEASIYLWHHTDKIIVSDIDGTVTK-----------SDVVG 458
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75029407   572 HVIPAIGG--TWAHTGVAELYTRIKNNGYKMVYLSSRAIGQSHTTKQYLKSVAQDS-KQLPDGPVLLSPTSIITAFRREV 648
gi 74832598   458 HIMPLIGR--DWTHPGICSLYSQIQKNGYRLVYLTARSVSQISMTRKFLWNIQQNG-VSLPKGPVLTAPKRLFSALAQEV 534
gi 122021472  471 HLMPLIGR--DWTHPGICSLYSKIDRNGYKFVYLTARSVSQVSMTRNFLWNIEQDG-FRLPKGPVLTAPQRFFTALTQEV 547
gi 290990024  352 QVYSRMGK--DYTHPGIAKLFQSIAENNYKFIYLSARPITMSQLTREYINSVYQDG-YKMPPGPIITSPNKAFSALAREV 428
gi 568015418  416 RMFKRRDS--AAMHPGAVEFYSKLARNGYRVVYVTCLGLSQANLIHALLHNSTEDGeIALPMGPVLLSPDRLL-AYSNEM 492
gi 298712787 1191 ----------PGVHKDVSTLFSKISGNGYKILYLTNRPLPDWHAKRG-AAAAAEGG-VALPRGPVLCPPEVLFRGTSSKD 1258
gi 146071649  677 HFYAMLGKgaDWTHPGICNLYSKIERNGYRMVYLTARSVSQINQTKSYLFTLQQDG-VRLPMGPVLTAPQRFFTALTQEV 755
gi 402468048  465 HVYTMIGK--DWTHAGVAGLFTKIVKNDYKIVYLSSRPIGQMEYTKKYLSGIKQNG-CELPDGPVLLSPDGLFGAIYREM 541
gi 906372932  303 YIYGAMGK--DWTHLGIAALYNKIVENGYKIVYLSSRPIGHIGFTKAYLERVEQEE-QNLPAGPVILFPGRLLSAIYREM 379
gi 313228616  459 QLSNIVYY--EYSHHGIHNLYNNIAKNNYKFMYVSSRAISQSHMTKTYINWTEKDG-KYLPNGPVLLNPSSLVSALLREV 535
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75029407   649 IERRPEEFKIAALTDLKQLFP-SGN--PFYAGFGNRITDVVSYEAVAVPAARILIIDP-SGKVKRSd---SSGLALSYKS 721
gi 74832598   535 -AMKSHFFKIACLQKVVNAFPqKTK--PFYAGFGNRLSDMLSYLAVMVPEHKIYVVDS-KSLVRVA------NVTSTYQR 604
gi 122021472  548 -SKKSHVFKIACLKSVLDTFPaQSK--PFYAGFGNRFNDVVSYTATQIPQHKIFIIDP-NSVLHVY------NVRQTYKN 617
gi 290990024  429 VIRRPETFKINCLGSIASLFPtDF---PFYSGFGNRPTDCISYVSVNIDPTRCYRINK-QGKLLVQa---TKVTYNSYAE 501
gi 568015418  493 I--DAEDFKIAALGALRSLFPrEVN--PFYAAFGTTQTDSVVFTQVGVFSGKVFVVDPtDGSLRHRs---LMGFHESYTS 565
gi 298712787 1259 RRSHHEVFKMTALRGLKLIFPaDVN--PLYGGFGNSVSDMVAYKKMAVPEGRIFLINS-MGEL-HNi---NHTYRQTYLS 1331
gi 146071649  756 -SKQSHVFKIACLTSVRAAFPpSTK--PFFAGFGNRYNDVISYDAAGIPTHKIFIIDP-SSVLHVC------LVRQTYRD 825
gi 402468048  542 ILKRPEEFKIACLKTLQSLFSt----nPLFGGFGNRQTDVITYRTVGIDISRIFTIDS-YGVIIPEc---STTISGSYLT 613
gi 906372932  380 V-QGPEEFKISVISEIKGLMSq----gRIYAGFGNKESDRIAYEVCEIDPGRIFIVNT-MSEISTGr---KGIVKLTHCS 450
gi 313228616  536 WTRNPEEFKIDCLTGIRNLFP-GYQptPFYAGFGNKMTDETSYLEVEIPKKRIFTISK-KGVVKNSdpslQKIFSTTYDS 613
                         250
                  ....*....|.
gi 75029407   722 MAsDTVDYMFP 732
gi 74832598   605 LA-DDVDSSFP 614
gi 122021472  618 LA-HLVDVTFP 627
gi 290990024  502 IE-SQLLKHFP 511
gi 568015418  566 LL-DRMDSMFP 575
gi 298712787 1332 LS-RHVDLTFP 1341
gi 146071649  826 LG-HLVDVTFP 835
gi 402468048  614 LN-SIVDNIFP 623
gi 906372932  451 LY-DIVDGVFP 460
gi 313228616  614 MA-EIVDFFFP 623
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap