Conserved Protein Domain Family
LNS2

?
pfam08235: LNS2 
LNS2 (Lipin/Ned1/Smp2)
This domain is found in Saccharomyces cerevisiae protein SMP2, proteins with an N-terminal lipin domain (Pfam: PF04571). SMP2 (also known as PAH1) is involved in plasmid maintenance and respiration, and has been identified as a Mg2+-dependent phosphatidate phosphatase (EC:3.1.3.4) that contains a haloacid dehalogenase (HAD)-like domain. Lipin proteins are involved in adipose tissue development and insulin resistance.
Statistics
?
PSSM-Id: 311931
View PSSM: pfam08235
Aligned: 88 rows
Threshold Bit Score: 272.808
Threshold Setting Gi: 124457893
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75029407   507 QSLRLSSEKLKSLGLVFGANELRFSITTKFQGT-TWCSCNIYLYKWYEQIVVSDIDGTITK-----------SDVLGHVI 574
gi 74832598   393 RSLVPMEADLLKLNLVPGHNRIRYITHSSLRGE-VAVEANVYLWDSTDRLVISDVDGTITK-----------SDVLGHIM 460
gi 122021472  406 RTLIPTEADLRKLNLVEGHNQVRYITHSSLRGE-VAVDANVYLWDSTDRLVVSDVDGTITK-----------SDLWGHLM 473
gi 568015418  350 KSLKPSQQELVDMGLCVGMNDIAFVLRSHDSGElARVTAKLYLWPVTAKVVIAQIDGAISS-----------SAATGRMF 418
gi 298712787 1115 KTLRPTSEQLAALRLRPGCNTIEFVVNVAGQAE-RVVSARAFLWGSGARVVVSDIENTIARsggggsgrgsfSQVIG--- 1190
gi 146071649  612 rtIIPVEADLWKLHLKEGCNTVRYLARKDKGDI-VSISCNIFLWNWTDRLVVSDVDGTITK-----------SDLLGHFY 679
gi 474051454 1318 RSLTPTSEELASLHLREGRNIVTFTFSTAMLGT-QQVDAHIYLWEWNAHIVISDVDGTITK-----------SDVLGQFM 1385
gi 923630247  564 rTNVPTNEQIASLNLKDGQNMITFSFSTRVLGT-QQVDAHIYRWRWDTKIVISDVDGTITK-----------SDVLGQFM 631
gi 303278029  609 KSITLNSDQVSALGLRPGKNVIAFSFQSRVWGR-QEVQAHAYLWDWNAKVVVSDVDGTITK-----------SDVLGHLA 676
gi 290991380  664 KSLKPTSDELKSLGLKDGKNEIKFLVTSRILGT-QEVNAYIYFWKYSDKIVISDVDGTITK-----------SDALGHIL 731
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75029407   575 PAIGG--TWAHTGVAELYTRIKNNGYKMVYLSSRAIGQSHTTKQYLKSVAQDS-KQLPDGPVLLSPTSIITAFRREVIER 651
gi 74832598   461 PLIGR--DWTHPGICSLYSQIQKNGYRLVYLTARSVSQISMTRKFLWNIQQNG-VSLPKGPVLTAPKRLFSALAQEV-AM 536
gi 122021472  474 PLIGR--DWTHPGICSLYSKIDRNGYKFVYLTARSVSQVSMTRNFLWNIEQDG-FRLPKGPVLTAPQRFFTALTQEV-SK 549
gi 568015418  419 KRRDS--AAMHPGAVEFYSKLARNGYRVVYVTCLGLSQANLIHALLHNSTEDGeIALPMGPVLLSPDRLL-AYSNEMI-- 493
gi 298712787 1191 -------PGVHKDVSTLFSKISGNGYKILYLTNRPLPDWHAKRG-AAAAAEGG-VALPRGPVLCPPEVLFRGTSSKDRRS 1261
gi 146071649  680 AMLGKgaDWTHPGICNLYSKIERNGYRMVYLTARSVSQINQTKSYLFTLQQDG-VRLPMGPVLTAPQRFFTALTQEV-SK 757
gi 474051454 1386 PMVGV--DWSQNGVAHLFSAIQENGYHLLFLSARSISQAHLTRQFLFNLKQDG-KALPDGPVVISPDGLFPSLYREVIRR 1462
gi 923630247  632 PLVGK--DWTQSGVAKLFSAIKENGYQLLFLSARAIVQAYLTRSFLNNLKQDG-KALPNGPVVISPDGLFPALYREVIRR 708
gi 303278029  677 PMVGK--DWNHAGVATLYNNIKDNGYQLMFLSSRAISQSKNTRQYLEKLTQDG-ETLTQGPVMLAPDPLSTALYREVVVR 753
gi 290991380  732 PMLGQ--DWSHSGIGKLYSKIAENGYRILYLTSRSIIQSGSTKRYIFTLQQED-AMLPEGPVVMSPDRLFAALHREVILK 808
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75029407   652 RPEEFKIAALTDLKQLFP-SGNPFYAGFGNRITDVVSYEAVAVPAARILIIDP-SGKVKRSdSSGLALSYK--SMAsDTV 727
gi 74832598   537 KSHFFKIACLQKVVNAFPqKTKPFYAGFGNRLSDMLSYLAVMVPEHKIYVVDS-KSLVRVA---NVTSTYQ--RLA-DDV 609
gi 122021472  550 KSHVFKIACLKSVLDTFPaQSKPFYAGFGNRFNDVVSYTATQIPQHKIFIIDP-NSVLHVY---NVRQTYK--NLA-HLV 622
gi 568015418  494 DAEDFKIAALGALRSLFPrEVNPFYAAFGTTQTDSVVFTQVGVFSGKVFVVDPtDGSLRHRsLMGFHESYT--SLL-DRM 570
gi 298712787 1262 HHEVFKMTALRGLKLIFPaDVNPLYGGFGNSVSDMVAYKKMAVPEGRIFLINS-MGEL-HNiNHTYRQTYL--SLS-RHV 1336
gi 146071649  758 QSHVFKIACLTSVRAAFPpSTKPFFAGFGNRYNDVISYDAAGIPTHKIFIIDP-SSVLHVC---LVRQTYR--DLG-HLV 830
gi 474051454 1463 APHEFKISCLADIKALFPpDSHPFYAGFGNRDTDELSYLKVGIPMGKIFIINP-KGEVAVN-RRVNTKSYM--SLH-ALV 1537
gi 923630247  709 APHEFKIACLEDIRKLFPkDYNPFYAGFGNRDTDELSYRKLGIPKGKIFIINP-KGEVATGhRIDVKKSYT--SLH-TLV 784
gi 303278029  754 RPQEFKMRCLRTIRDLFPpEWNPFYAGFGNRETDTVSYASVGVPPGRNFTINP-KSEVVAE-VTKMTKRYTlaGIN-ELV 830
gi 290991380  809 KPEEFKKAALSDVLELFPqDSNPFFAGFGNRVNDQISYSFVGVPDHKIFTINP-TGLIQVY--GISHDSYW--NIY-KLV 882

                  ....*
gi 75029407   728 DYMFP 732
gi 74832598   610 DSSFP 614
gi 122021472  623 DVTFP 627
gi 568015418  571 DSMFP 575
gi 298712787 1337 DLTFP 1341
gi 146071649  831 DVTFP 835
gi 474051454 1538 NRVFP 1542
gi 923630247  785 NDMFP 789
gi 303278029  831 DEMFP 835
gi 290991380  883 DEMFP 887
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap