Conserved Protein Domain Family
YL1_C

?
pfam08265: YL1_C 
YL1 nuclear protein C-terminal domain
This domain is found in proteins of the YL1 family. These proteins have been shown to be DNA-binding and may be a transcription factor. This domain is found in proteins that are not YL1 proteins.
Statistics
?
PSSM-Id: 311942
View PSSM: pfam08265
Aligned: 199 rows
Threshold Bit Score: 31.9447
Threshold Setting Gi: 156397871
Created: 23-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30
                 ....*....|....*....|....*....|
gi 74635381  529 NCVVTGKPARFRDSKSkGLYYASLEAFKVI 558
gi 675880824  41 YSDLSGLPAPYTDPHT-KLRYATSEEYSRI 69
gi 195173833  29 YSDISGLPAPYMDPHT-KLRFANAEEYasm 57
gi 240976659  96 YSDTSGLPARYTDPAT-KLRYANVDEYARI 124
gi 260782749 131 YSDLSGLPASYTDPHT-KIRYANTDEFSRI 159
gi 196001817  43 YSDISGTIAKYTDPQT-KIRYSTSDEFKTI 71
gi 321477844 107 YSDLSGLLGNYTDPHT-HLRFAQADEYRTI 135
gi 684411406  87 VSDISGIPTAYTEPNT-RLNYATVDEFNTI 115
gi 754350557 462 YADVSSLPAPYMDPRT-KLRYATIPEFeya 490
gi 91078088   69 FSDLSGLPAPYTDPQT-RLRFANKEEYATL 97
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap