Conserved Protein Domain Family
Cadherin_2

?
pfam08266: Cadherin_2 
Click on image for an interactive view with Cn3D
Cadherin-like
This cadherin domain is usually the most N-terminal copy of the domain.
Statistics
?
PSSM-Id: 311943
View PSSM: pfam08266
Aligned: 49 rows
Threshold Bit Score: 118.014
Threshold Setting Gi: 149017288
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4ZPL_A         3 IRYSVAEEMESGSFVANVAKDLGLEVGKLAERGARLVAEGNRLHFRLHRKTGDLFVKEKLDREALCGKSDPCVLHFEIIL 82
gi 442570291  33 IRYAIPEELDRGSLVGNLAKDLGFGVGDLPTRNLRVIA--EKKFFTVSPENGNLLVSDRIDREEICGKKSTCVLEFEMVA 110
4ZI8_B        23 IHYEILEERERGFPVGNVVTDLGLDLGSLSARRLRVVSGASRRFFEVNWETGEMFVNDRLDREELCGTLPSCTVTLELVV 102
gi 47551313   34 IRYAIPEEARRGSAVGNVAADLALDPARLSGRRPRVVSGGSKKYFAVDAASGSLLVSERIDREELCGALSPCTLSFEIVL 113
gi 149017343  33 VRYSIPEELDRGSVVGNLAKDLGLSVLEVSARKLRVSA--EKMHFSVDSESGDLLVKDRIDREQICKGRRRCELQLEAVL 110
gi 914906461  32 IRYSIPEELAKGSRVGNLAKDLGLSVQELPARKLRVSA---EDYFSVSAESGDLLVSGRIDREKICGRKSECALEFESVI 108
gi 564393245  33 IRYKIPEEMPTGSVVGNLAKDLGFGVQELPTRKLRISS--EKPYFTVSSESGELLVSSRLDREQICGKKLVCSLEFEAVA 110
gi 57529036   29 FVYTVSEEANPGTTVGNLVKDFNLNIQDLEARGFHIVRGPNERYFDVNTKTGVLHVKERIDREEICEQNIKCSLPLEAMI 108
gi 57528959   29 IVYTVSEETNPGTTVGNLAKDLNLNLQDITNRGFQLVSGANKRYFELNSKTGFLHINDRINRDELCGRSLKCSLPLEAIV 108
gi 57528890   29 ISYNVLEEVKPGTTVGNLAKDINLSVKELQSRGFRIVSGSKKQYFSVNVDTGALQVSERIDREELCAGAVACSVNLEAVV 108

                 ..
4ZPL_A        83 AE 84
gi 442570291 111 EK 112
4ZI8_B       103 EN 104
gi 47551313  114 EK 115
gi 149017343 111 EN 112
gi 914906461 109 EN 110
gi 564393245 111 EN 112
gi 57529036  109 Ss 110
gi 57528959  109 Na 110
gi 57528890  109 Ns 110
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap