Conserved Protein Domain Family
Meth_synt_1

?
pfam08267: Meth_synt_1 
Click on image for an interactive view with Cn3D
Cobalamin-independent synthase, N-terminal domain
The N-terminal domain and C-terminal domains of cobalamin-independent synthases together define a catalytic cleft in the enzyme. The N-terminal domain is thought to bind the substrate, in particular, the negatively charged polyglutamate chain. The N-terminal domain is also thought to stabilize a loop from the C-terminal domain.
Statistics
?
PSSM-Id: 311944
View PSSM: pfam08267
Aligned: 49 rows
Threshold Bit Score: 394.254
Threshold Setting Gi: 81437908
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1U22_A         3 SHIVGYPRXGPKRELKFALESFWDGKSTAEDLQKVSADLRSSIWKQXSaaGTk----fIPSNTFAHYDQVLDTTAXLGAV 78
gi 122242454  51 SHIVGYPRIGPKRELKFALESFWDGKTNVDDLQNVAANLRKSIWKHMAhaGIk----yIPSNTFSYYDQMLDTTAMLGAV 126
gi 30173106   12 ATVYGYPRQGPNRELKKAIEGYWKGRVSAPELRSLAADLRAANWRRLAdaGId----eVPAGDFSYYDHVLDTTVMVGAI 87
gi 81437908    4 GTILGYPRLGPRRELRDYLYSYWQGKISEEVLEEKTRLLREETHRRLIllGLsaenysIP-ESFSYYDHVLDAAVHVGAV 82
gi 30173088    7 STVAGLPRIGAKRELKFALEGYWNGSIEGRELAQTARQLVNTASDSLS--GLd----sVPFAGRSYYDAMLDTAAILGVL 80
gi 30173071    7 STIAGVPRIGAHRELKFALEGFWSGTVSGRELGQTATTLTNDYCDQLAaaGLd----sIPTAGRSYYDAMLDTTALLGVF 82
gi 51316293    8 ATVVGSPRIGPKRELKRATEGYWAGRTGRAELEKVAATLRRDTWAGLAaaGLd----sVPVNTFSYYDQMLDTAVMLDAL 83
gi 3334256    12 ATVTGSPRIGPRRELKRATEGYWAKRTSRSELESVASTLRRDMWSDLAaaGLd----sVPVNTFSYYDQMLDTAFMLGAL 87
gi 30173096    6 SSNLGYPRLGEKREWKRALEKFWNGAISEEELLAETKALRLHALKKQQekGId----lIPVGDFSFYDQVLDTSVTFGII 81
gi 38258049    5 NSNLGYPRLGEHREWKHLLEHFWKGQLDNVTFHATAKKLRLANLKKQRdlGVd----yIPVADNSDYDHVLDTLVAFNAI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1U22_A        79 PPRYGytg------geIGLDVYFSXARGNASVPAXEXTKWFDTNYHYIVPELGPEVNFSYASHKAVNEYKEA-KALGvDT 151
gi 122242454 127 PSRYGwes------geIGFDVYFSMARGNASAHAMEMTKWFDTNYHYIVPELGPDVNFSYASHKAVVEFKEA-KALGiDT 199
gi 30173106   88 PERHRaav------aaDALDGYFAMARGTQEVAPLEMTKWFDTNYHYLVPELGPDTVFTADSTKQVTELAEA-VALGlTA 160
gi 81437908   83 PSRFSwlln----dgiVDLNAYFTLARGDRSLAPLESLRYFGSSYHYLVPEIDGNTHFALTSHRVITQFEQA-KQAGvNV 157
gi 30173088   81 PERFDdiadhendglpLWIDRYFGAARGTETLPAQAMTKWFDTNYHYLVPELSADTRFVLDASALIEDLRCQ-QVRGvNA 159
gi 30173071   83 PERFQnlddhpndglpAHIDRYFATARGTAELPASAMTKWFDTNYHYLVPELSADTRFILDDTALLTDIHDQ-LTRGhDV 161
gi 51316293   84 PERarq--------vsDDLDRYFAAARGNSDVAPLEMTKWFDTNYHYIVPEIAPTTKFALNPDKVLSELKEA-LAQGiPA 154
gi 3334256    88 PARvaq--------vsDDLDQYFALARGNNDIKPLEMTKWFDTNYHYLVPEIEPATTFSLNPGKILGELKEA-LEQRiPS 158
gi 30173096   82 PKRFQhdg------gkVSLNTYFDIARGKSDAVASEMTKWFNTNYHYIVPELADA-DPKVLDNRALYYYEEAkKELGiEG 154
gi 38258049   81 PSRFGhfd------hqLDLPDYYAIARGTDTAVAAEMTKWFNINYHYIVPEFDDV-SFKLLDNRWLRYYQEAkQELGiDG 153
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1U22_A       152 VPVLVGPVSYLLLSKAAKGVdksfELLsLLPKILPIYKEVITELKAAGATWIQLDEPVLVXDL--EGQKLQAFTGAYAEL 229
gi 122242454 200 VPVLIGPMTYLLLSKPAKGVeksfCLLsLIDKILPVYKEVLADLKSAGARWIQFDEPILVMDL--DTSQLQAFSDAYSHM 277
gi 30173106  161 RPVLVGPVTYLLLAKPAPGApadfEPLtLLDRLLPVYAEVLTDLRAAGAEWVQLDEPAFVQDR--TPAELNALERAYREL 238
gi 81437908  158 RPTILGPVSLLMMSRSHGPNa--iNPIeRLQDLVPVYSELFEKLYNSGCKFVQVDEPAVTHNTfgIQKSQELLVDAYKFL 235
gi 30173088  160 RPVLVGPLTFLSLARTTDGS----NPLdHLPALFEVYERLIKSFDTE---WVQIDEPALVTDV--APEVLEQVRAGYTTL 230
gi 30173071  162 RPVLIGPLTYLSLSRTTDGS----DPLdHLETLFEVFERLLAKLPTP---WVQLDEPSLVTDV--APEVLERVRAGYARL 232
gi 51316293  155 RPVVIGPITFLLLSKGVDGAg---APIeRLEELVPIYAELLSLLADNGAQWVQLDEPALVTDM--CADAPALAEAVYNKL 229
gi 3334256   159 RPVIIGPVTFLLLSKGINGGg---APIqRLEELVGIYCTLLSLLAENGARWVQFDEPALVTDL--SPDAPALAEAVYTAL 233
gi 30173096  155 KPVLVGPVTYLKLGKGNDAE----NFEaLLDKFIPAYVEILKELERAGAKWVQIDEPYLATSF--DKSEIKLFEKVYQAF 228
gi 38258049  154 KPVILGPISFLKLGKRHGQYlddaAVNeLLPQLLPLYQQVFEELATAGAKWIQLDEPTLVKTT--TVAELAPYQTALEHL 231
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1U22_A       230 EsTLSGLNVLVETYFADiPAEAYKTLTSLK-GVtAFGFDLVR-GTKTLDLVKA-GFp--EGKYLFAGVVDGRNIWANDFA 304
gi 122242454 278 EsSLAGLNVLIATYFADvPAEAYKTLMSLKcVT-GFGFDLVR-GLETLDLIKM-NFp--RGKLLFAGVVDGRNIWANDLS 352
gi 30173106  239 GaLTDRPKLLVASYFDR-LGDALPVLAKAP-IE-GLALDFTDaAATNLDALAAvGGl--PGKRLVAGVVNGRNIWINDLQ 313
gi 81437908  236 SsRKLRPEILVAMSYGN-AADQVDALATTG-VE-AMAFNLI-------DGAVPfANpslADKALFGGVIDGRNIWRGDLA 305
gi 30173088  231 A---KRDGVFVNTYFGS-GDQALNTLAGIG-LG-AIGVDLVThGVTELAAWK-------GEELLVAGIVDGRNIWRTDLC 297
gi 30173071  233 A---TRGGVFVNTYFGA-GDQALDTLAGLG-LG-AIGVDLVSdGVTALEAWK-------GEELLVAGIVDGRNVWRTDLC 299
gi 51316293  230 GsASNRPAIYVATYFGD-PGASLAGLARTP-VE-AIGVDLVYgPDTAVAAVPEl-----AGKTVVAGVVDGRNVWRTDLA 301
gi 3334256   234 GsVSKRPAIYVATYFGN-PGASLAGLARTP-IE-AIGVDFVCgADTSVAAVPEl-----AGKTLVAGIVDGRNIWRTDLE 305
gi 30173096  229 QtAVPNLKIELQTYFES--LDYYEEVVNLP-VA-AIGIDFVHdHGDSLEALKAhGFp--EDKYLAAGVIDGRNVWRSDLD 302
gi 38258049  232 HaAVPSLKIELQTYFDS--LDQYDKIVTWP-IQ-ALGLDLVHdHGENLAHLVDhGFp--TDKILAAGIIDGHNVWASDLQ 305
                        330
                 ....*....|...
1U22_A       305 ASLSTLQALEGIV 317
gi 122242454 353 ASLKTLQTLEDIv 365
gi 30173106  314 KSLSTLGTLLGLA 326
gi 81437908  306 AAYYKLERLRELS 318
gi 30173088  298 AALASLKRLAARG 310
gi 30173071  300 AALGTLRRLQARG 312
gi 51316293  302 AALDKLTTLLGSA 314
gi 3334256   306 SALSKLATLLGSA 318
gi 30173096  303 AKLSLLTEIADYV 315
gi 38258049  306 AKLALVQQLRQIV 318
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap