1J1V,3PVP,2HCB,2Z4R


Conserved Protein Domain Family
Bac_DnaA_C

?
pfam08299: Bac_DnaA_C 
Click on image for an interactive view with Cn3D
Bacterial dnaA protein helix-turn-helix
Statistics
?
PSSM-Id: 336990
View PSSM: pfam08299
Aligned: 721 rows
Threshold Bit Score: 35.4353
Threshold Setting Gi: 551024521
Created: 23-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1J1V_A         3 IDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQXAXALAKELtNH-SLPEIGDAFgGRDHTTVLHACRKI 71
gi 81835185  329 IKAITTAVARQLGVKSADMRSGSRRQNIVRARSLAMWLARRLtED-SLTQIGDAFgGRDHSTVLHAIRKI 397
gi 510022940 102 PEAIIQAVADQFGVDAAEIVGTNRNKDVSLARHVAMYLCRELlPEqRARHIGAAFgRRDHTTFLYACQRI 171
gi 927051893 188 VDRILQEVADYFKVLPKEIRSKKRHKTLVTARHVAVYLIRELtQK-SYPEIGRELgGRDHSTAIYSFKMv 256
gi 504261125 371 VERILAEVAGYYGVTSKDIRSRKRTRSMVVARHMAAYLIRDIgHK-SYPEIGRELgGRDHSTIIHSCKYI 439
gi 524381634 212 yhrtvKAVQDTCGIASMDFLGPSRTKKCVQARNISMYLYREL-SGdTLSNTGKLF-ERDHTTIIHSIEQI 279
gi 918698398 387 VAKIIQAVADLSGVTKVEILSKSRLAKLVYLRQMVAYLAKEI-TKsSLQEIGKQLgGKDHATIIYYIRqf 455
gi 505358733 101 fQHIKQAIAEGMGVSFFDIIGESREQKHVFSRMIFAQLCRE--EGaTVVRIAKEM-KRNHATIIYYLRKy 167
gi 815048159  26 VKDIKKAVTVYYGLSYKDVEGHARQRKLTTARHMIVYLSHELsDT-SWTQIGYELgKRDHSTIKSSyera 94
gi 737420734 362 IKKIKKAVTRFYGLTYKDIEGKSRQKKLMNARHVFVYLSRELlHK-AYISIGQELgNRDHTTISSSYera 430
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap