4AEZ,3ESL


Conserved Protein Domain Family
Mad3_BUB1_I

?
pfam08311: Mad3_BUB1_I 
Click on image for an interactive view with Cn3D
Mad3/BUB1 homology region 1
Proteins containing this domain are checkpoint proteins involved in cell division. This region has been shown to be essential for the binding of the binding of BUB1 and MAD3 to CDC20p.
Statistics
?
PSSM-Id: 336992
View PSSM: pfam08311
Aligned: 165 rows
Threshold Bit Score: 89.8444
Threshold Setting Gi: 74956291
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4AEZ_C          53 KERMGHERKIETSesLDDPLQVWIDYIKWTLDNFPQgetKTSGLVTLLERCTREFVRNPLYKDDVRYLRIWMQYVNYIDE 132
gi 642924396    40 QQQSEFERQIATYt-GDDPLELWYQYISWVEQSYPKq-gHEGNLGALLERCLCLFEKDPRYRNDRRLCKLFIKYIDQHQN 117
gi 242008295    49 RQRNEYEIRLRNSc-SEDPLSDWCSYIYWIEQSFPKq-gREGKLHVVLQKCLNKFKDNEQYMNDIRFVRLCIKYADLEDN 126
gi 1134483921   24 sdKRAWDEAIRAYq-GPDPLDIWFNFICWLEQHKMLd--KEGGFRKILEQCLSNFENYENYKQDVRMVKLWMKFIDMQAN 100
gi 568249035    39 ADKHAWEEAIRRYv-GNDPLDLWFNYVNWYEQNR-Sy-dRVNNLRPILEKCLAQYQETESYKQDIRLVKLWMKFIDMQAE 115
gi 321463581    42 EQRKAMELDIMAYd-GSDPLELWSRYIQWVEENYPQg-gKESDLQMVLEQCLEKLRDSPQYQSDPRLLEIYLRYLDLTEN 119
gi 1036907339   32 KDKQAWEHAISLYq-GPDPLDHWYNYICWYE-NLAHs-dPELKFRETLERCLTEYEHSEYYRQDARMVRLWLKYIAMQTD 108
gi 118784980    20 ADKQAWEDAIRGYn-GTDPLDLWFNYITWYEQNR-Sf-dRLNNLRSIVEKCLLLYQDAEGYKQDTRMVKIWMKYIDMQQS 96
gi 749797991    44 QEKQMYEDAIKHy-eGEDPLESWYEYILWVEQSYPKn-gHESHIGRLLQQCLTLFEKEVKYHQDRRYIRLWINYISMQKN 121
gi 645011755    44 QERQMYEDTIKNy-vGDDPLENWYDYISWVEQSYPKs-gHESPLARLLQQCLTNFEKETKYHQDQRFIRLWINYISMQKN 121
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....
4AEZ_C         133 PVELFSFLAHHHIGQESSIFYEEYANYFESRGLFQKADEVYQKG 176
gi 642924396   118 PLELYHMMYASELCRGCADMYRAWAYYYEATGDFQNAHIIFEya 161
gi 242008295   127 TVELLSQIHRHGIGVSCAELYIAWAEKYAVDNCFKKANAVYERG 170
gi 1134483921  101 PLNLYQFLYKKNVGTQCACFYIGWAHYYDAANAFKQAESIFNLG 144
gi 568249035   116 PPSWYQMLYNKKIGTQCASFYISWAHYCNVAKAYKQADSIYNLG 159
gi 321463581   120 NAEWYNQLYGAGYFHKLASFYIHWAETLEACSNFKEGTRIYMLG 163
gi 1036907339  109 PLHFYQVLFQRGSGRQVAAFYIGWASYYESREQFKDAEAVFNLA 152
gi 118784980    97 PASYYQMMYKKNIGTQCASFYIGWAE-----RDYKQAVSIFNLG 135
gi 749797991   122 PLELYHLLHNNGIGTTVADMYRAWAFELEQIEDYKRADEVYLMG 165
gi 645011755   122 PLELYQLLYNNGIGTMVADLYRAWAFELEQVEDFKRADEVYMIG 165
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap