Conserved Protein Domain Family
Spc7

?
pfam08317: Spc7 
Spc7 kinetochore protein
This domain is found in cell division proteins which are required for kinetochore-spindle association.
Statistics
?
PSSM-Id: 336997
View PSSM: pfam08317
Aligned: 56 rows
Threshold Bit Score: 225.188
Threshold Setting Gi: 754401559
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74595307   984 PEFEPIHLQDFLNMTNIHF--ME-L-----TTTK--RRHTTAPDSISKraarlslegDGKSSASNFDDCVAAGFCTVPML 1053
gi 74605655   359 SQSGPISLQTFFDAANIKF--NV-DtqineFQID--LKSTNNIEHVPS------------------NIIYQALYCKIPIL 415
gi 74693054   438 EPVEPISLQMFLDTTGISFv-IDlD------GVQ--NYDPITFTYTDR------------IEDISTRQIYDALYLQIPLL 496
gi 359384639  689 EAYSPVTLYDFLRDISIRF--YD-Dl---eIGTKqvDRISLSLTKIN------------ENEDWPFDDYVEAMN-KIPLL 749
gi 363749167  427 EAIEPISLESFLDATGVSF--LI-D-----LQII--EK--IEKIEFRY---------TEDITKVSTAQIYNALYLQIPIL 485
gi 598073253  578 edyePIKLSQFLQDIGIQF--YD-D-----------RELDLNSFPRFS---------NPDQSNITMTDYISSIP-KLPVL 633
gi 156848804  372 kEFQSYSIKEFLKEINISF--KI-Dn---eVGNS--DESTLNFTLIDP---------A-QITGIRINQLYNTYYVDIPIL 433
gi 367005480  375 lESNRHSIKDFLRELNLDFdqYN-T-----VSGE--EKQDIIFKLSQ----------LSETNGVPINQLYNFFYIDTPIF 436
gi 927374523  427 DDYVHVTLPQFLNQVQVQF--YD-N-----IGPS--ERELTVT--------------SEGSGSQALHKYVDA-VTEFPNF 481
gi 754401559  512 deyaPVPLKQFLEDLGVEF--FD-N-----LNIN--EDFTVVLNQIEN---------NTEVKKI---DYLKAKSIKIPWL 569
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74595307  1054 ELYQHSCRELKSYISEGRQIIRSIETETYAD-NPPL-FREYMAAAPDIRLL-MDNQFRNVKTHTRLLSKATWYEWRMKLL 1130
gi 74605655   416 EIQAFTAKELTRRILQSRNLLKSLREQIASNePPRL-IKEYFEADTDTRYA-INEKLELVTIMARLQSEKVWFEWRSQHL 493
gi 74693054   497 EIYAFIVKELHRRILDSQRLFQELEEQISNNpPPYL-FRNYFESSDEVKQL-MKEQIVLIKSFARLEAKKVWFEWRCQHL 574
gi 359384639  750 ELYDFSCKELSKNINEGKTMFEQFDDVTREN-NPKL-FREYYSAGPNEQLG-MKSEFQLIKDFARQQSKEVWYSWRTQLV 826
gi 363749167  486 EIYSFIVKELYRRIHDSQELFHEVQEQISNN-SPPLlFRSYFESSDEVKKL-MNEQIVLIKSFARMEAKKVWLEWRCQHL 563
gi 598073253  634 QLYEFSNSELNKNLMDTRNLFNAFNTHIEMN-NPTM-FRQYYKSDEQAQAQ-MNQRFARVREYMRQSSHKKWYEWRYNMI 710
gi 156848804  434 EMNTFISKELLRRISQSKVLFEDLEERVIKE-SPPLlFREYFSSEAEIKNI-AKSQLQLVKKYSSLEAKKAWYEWRIQHL 511
gi 367005480  437 EMNTFIITELLKKISNSKSILDDLDNQTISN-PPPI-IAEYYASDLSHKQS-ISQKMLTIKNYSGLLAQRGWYEWRIQHL 513
gi 927374523  482 DYFYHLIAQRKSGIDRSQRSINDFSEAIINN-NPTS-VREFYESTDEVQKD-LKVNYQALASLARTIAEHGNLVFMTNSL 558
gi 754401559  570 ELYSFSCSELQKDMSKLKLFLDNYNDEFIEE-NPQL-VREYYQIRDTQEQRrLSDSLLLMKTLSDKEAEVSWLEWSYQLL 647
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74595307  1131 EGLKEGLDRHVEEMKGDDNLLSKHEAILKDAMPALSAKHSSLKEEAAQLQQ-----LADELENC-D-QDELWNARGKLSD 1203
gi 74605655   494 KGIKTVLEENIAILVDENAQIMKYMNEINDVKIRVSDIKQVLMKELDVLRQhn-dvFSNKKENI-TtLLKVNKLKGDLRE 571
gi 74693054   575 KGIKSVLEENLSLVQTEYAEVVARLNEISDIKHRLQALEQSLRHELELLRNge-kpMR--VTTL-AdRLKIEKIKSELKA 650
gi 359384639  827 QNLFDQLGDKYDLLLQDKDILQDSLSTINELFDEITAKKNLLMQRLTSFES-----FESQCDSI-T-DDDLESMQKELES 899
gi 363749167  564 KGIKSVLEENLSLVQTEYAGVVKHLNEINDIKDRVKTIEQTLMRELQTLKNgg--pVVRHGSSIaE-RMKIEKLKRELSD 640
gi 598073253  711 SALLDKSRERYSELVNDRQCLISDIDQLQKLRLKFHGYLQQLRRRLTDLKQ-----VTSQIGKI-P-AGELEKLSIELKS 783
gi 156848804  512 VGIKNVLIENLSILKEEFEKVNTDLENIQEIKNKVESLKDRIRQEIKLIRElp-pdYYQNHPNLkD-KLRLEQLKQELVS 589
gi 367005480  514 LGLQNVLQENITILNEELEKISEDLENVKNIKNRTDSIRASIRREIRLLKElpaakYNKESTLN-D-KINIENLKQELMA 591
gi 927374523  559 EGLLKSYENRKASVNSQVADMEEIRAAFTSEYQKSVKRKADLTKTLALLQD-----RQKNFANV-D-LDKLELLKSRVEA 631
gi 754401559  648 NELDNRLIDHLDIIEKDSINISNKVKELTNFEEELDLELENLSEQMNDLIE-----QNEIFQAS-Q-NEDVMQTRNNLYK 720
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74595307  1204 LEEEIAAKRQVLEELQTQIQDKTDTIETGTELKAEVMAQIQEAERVKEECRGWSAKEIRELKDSVHRIEQRTGWSISSAS 1283
gi 74605655   572 NMLKVS----DLNQLTTKKDQLTQKIQDAKLEMSKVNEEIAQLRQDLKQSKVCTEYDVAKLKLVHQLYQSISGIKFRKLV 647
gi 74693054   651 NMIKLN----NTANLEEQKEAISADINALRSQIKDVREEISSLKSLVLKNKLHTAHDVSKLRLLFSQMQLFTGVSFRGLS 726
gi 359384639  900 CKEKYHYLKEVEMERQLRLEEISIKIQKNKELISTFNKDINEHEKIINDNRKYEKSEIEQLKTKYNMLQSITNLKYNSMK 979
gi 363749167  641 NMVKLN----GLEDLEKQRTIIRENKSKLHSQIAAVKKEIDSLKALLNRKKIHSSYDVKKLQNMFSQIQLFTGINFVKLV 716
gi 598073253  784 HKLKMAELGNKIVDRTGELERINVKLADIGNKRTELVSELSQAQQVVQKTKLNDKSEVIARHLTFKFLQQITKLQFVNED 863
gi 156848804  590 HSVKI----GQIKELQNKRNDVLTKISKTKESLSQTKLELENSNRAQRLDSHFSEFELNRLKNRFSMFQTLSGIEFVSLK 665
gi 367005480  592 NGIKLE----EYTTLKTKKEGLLLYVKEMNDKITSVRKEISALAADTMKGKVFTTYDISRLKMKFSLLQNITNVKFVSMV 667
gi 927374523  632 AQEQNARLREAKAKLQKEIAEKEEIFKLVSTQLLEAQEEDKRLKKRVMELKLPSQNELDLLQQQFVDLQRTTQVELLVLN 711
gi 754401559  721 ILKDLNNQEENLEKCQIKNDELSQKV----SQYKEIEEIVEQKEHIVKINGMDLDTRVQIWTKQFVALQSISGIKLLSLN 796
                         330       340
                  ....*....|....*....|....*..
gi 74595307  1284 ssetGLAVTMVYR-HQ--LQLKFYPAS 1307
gi 74605655   648 ----GPVLSVSLH-DDk-VIVTADLSK 668
gi 74693054   727 ----GSELQLALN-ST--INVSFDLTQ 746
gi 359384639  980 ----QNVISFTFY-NT--LNIKMDFSd 999
gi 363749167  717 ----GSELHLSLKaNK--VNIGFDLlk 737
gi 598073253  864 ----NGVWEFIYY-QD--IKCRFDIKN 883
gi 156848804  666 ----KSTLIVKSP-IEefPEIVIDLSK 687
gi 367005480  668 ----NSTLQIKLN-IKmfpvinvemrn 689
gi 927374523  712 ----EKEFKVQIM-KE--LQISVDLSt 731
gi 754401559  797 ----DTILNVSFA-SNm-ITASIDLTK 817
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap