Conserved Protein Domain Family
Spc7

?
pfam08317: Spc7 
Spc7 kinetochore protein
This domain is found in cell division proteins which are required for kinetochore-spindle association.
Statistics
?
PSSM-Id: 311978
View PSSM: pfam08317
Aligned: 57 rows
Threshold Bit Score: 217.482
Threshold Setting Gi: 459372745
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74582228   877 PNVEPISLSDFLKMTGIEF-LDnL----------TIAKRRETLLPNAEEN---KKCSIQELLESFYIQFpLLELYKFSCQ 942
gi 74605655   359 SQSGPISLQTFFDAANIKF-NV-Dtqi-----neFQIDLKSTNNIEHVPS--------NIIYQALYCKIpILEIQAFTAK 423
gi 74693054   438 EPVEPISLQMFLDTTGISFvIDlD-----------GVQNYDPITFTYTDRi--EDISTRQIYDALYLQIpLLEIYAFIVK 504
gi 754401559  512 DEYAPVPLKQFLEDLGVEF-FD-Nln----------inEDFTVVLNQIENn--TEVKKIDYLKAKSIKIpWLELYSFSCS 577
gi 927374523  427 DDYVHVTLPQFLNQVQVQF-YD-N----------IGPSERELTVTSEGSG----SQALHKYVDAVT-EFpNFDYFYHLIA 489
gi 363749167  427 EAIEPISLESFLDATGVSFlIDlQ-----------IIEKIEKIEFRYTEDi--TKVSTAQIYNALYLQIpILEIYSFIVK 493
gi 367005480  375 LESNRHSIKDFLRELNLDFdqy----------ntVSGEEKQDIIFKLSQLsetNGVPINQLYNFFYIDTpIFEMNTFIIT 444
gi 156848804  372 KEFQSYSIKEFLKEINISF-KI-Dn--------eVGNSDESTLNFTLIDPaqiTGIRINQLYNTYYVDIpILEMNTFISK 441
gi 598073253  578 EDYEPIKLSQFLQDIGIQF-YD-DreldlnsfprFSNPDQSNITMT-------------DYISSIP-KLpVLQLYEFSNS 641
gi 448119595  689 EAYSPVTLYDFLRDISIRF-YD-Dle------igTKQVDRISLSLTKINEn--EDWPFDDYVEAMN-KIpLLELYDFSCK 757
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74582228   943 QLQDYIAEGKDFVTKIEEETLKE-NPLLFYEYRKASSDMRVL-MDSQFLMMKTFARLQAKGDWYEWREGLMQGIKHELNL 1020
gi 74605655   424 ELTRRILQSRNLLKSLREQIASNePPRLIKEYFEADTDTRYA-INEKLELVTIMARLQSEKVWFEWRSQHLKGIKTVLEE 502
gi 74693054   505 ELHRRILDSQRLFQELEEQISNNpPPYLFRNYFESSDEVKQL-MKEQIVLIKSFARLEAKKVWFEWRCQHLKGIKSVLEE 583
gi 754401559  578 ELQKDMSKLKLFLDNYNDEFIEE-NPQLVREYYQIRDTQEQRrLSDSLLLMKTLSDKEAEVSWLEWSYQLLNELDNRLID 656
gi 927374523  490 QRKSGIDRSQRSINDFSEAIINN-NPTSVREFYESTDEVQKD-LKVNYQALASLARTIAEHGNLVFMTNSLEGLLKSYEN 567
gi 363749167  494 ELYRRIHDSQELFHEVQEQISNNsPPLLFRSYFESSDEVKKL-MNEQIVLIKSFARMEAKKVWLEWRCQHLKGIKSVLEE 572
gi 367005480  445 ELLKKISNSKSILDDLDNQTISN-PPPIIAEYYASDLSHKQS-ISQKMLTIKNYSGLLAQRGWYEWRIQHLLGLQNVLQE 522
gi 156848804  442 ELLRRISQSKVLFEDLEERVIKEsPPLLFREYFSSEAEIKNI-AKSQLQLVKKYSSLEAKKAWYEWRIQHLVGIKNVLIE 520
gi 598073253  642 ELNKNLMDTRNLFNAFNTHIEMN-NPTMFRQYYKSDEQAQAQ-MNQRFARVREYMRQSSHKKWYEWRYNMISALLDKSRE 719
gi 448119595  758 ELSKNINEGKTMFEQFDDVTREN-NPKLFREYYSAGPNEQLG-MKSEFQLIKDFARQQSKEVWYSWRTQLVQNLFDQLGD 835
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74582228  1021 NLTGMQRSLTHLMDVANVIHPYAQEIQERYNgsiTTVQTLKKQKE----FANQ---YD-STLLAQAQEKLEKLKVEVERR 1092
gi 74605655   503 NIAILVDENAQIMKYMNEINDVKIRVSDIKQ---VLMKELDVLRQhndvFSNKkenITtLLKVNKLKGDLRENMLKVS-- 577
gi 74693054   584 NLSLVQTEYAEVVARLNEISDIKHRLQALEQ---SLRHELELLRNgekpMRvt--tLAdRLKIEKIKSELKANMIKLN-- 656
gi 754401559  657 HLDIIEKDSINISNKVKELTNFEEELDLELE---NLSEQMNDLIE----QNEIfqaSQ-NEDVMQTRNNLYKILKDLNNQ 728
gi 927374523  568 RKASVNSQVADMEEIRAAFTSEYQKSVKRKA---DLTKTLALLQD----RQKNfanVD-LDKLELLKSRVEAAQEQNARL 639
gi 363749167  573 NLSLVQTEYAGVVKHLNEINDIKDRVKTIEQ---TLMRELQTLKNggpvVRHgs-sIAeRMKIEKLKRELSDNMVKLN-- 646
gi 367005480  523 NITILNEELEKISEDLENVKNIKNRTDSIRA---SIRREIRLLKElpaaKYNKestLNdKINIENLKQELMANGIKLE-- 597
gi 156848804  521 NLSILKEEFEKVNTDLENIQEIKNKVESLKD---RIRQEIKLIRElppdYYQNhpnLKdKLRLEQLKQELVSHSVKIG-- 595
gi 598073253  720 RYSELVNDRQCLISDIDQLQKLRLKFHGYLQ---QLRRRLTDLKQvtsq----igkIP-AGELEKLSIELKSHKLKMAEL 791
gi 448119595  836 KYDLLLQDKDILQDSLSTINELFDEITAKKN---LLMQRLTSFES----FESQcdsIT-DDDLESMQKELESCKEKYHYL 907
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74582228  1093 RRLLSEKEERRKELAIKIEQVTNSCSDLELRTNAEQDFYAknqDFEFDEIKRYEEQLLNLKNELGWTIVSLTAGGIKLAT 1172
gi 74605655   578 --DLNQLTTKKDQLTQKIQDAKLEMSKVNEEIAQLRQDLKqskVCTEYDVAKLKLVHQLYQSISGIKFRKLVGPVLSVSL 655
gi 74693054   657 --NTANLEEQKEAISADINALRSQIKDVREEISSLKSLVLknkLHTAHDVSKLRLLFSQMQLFTGVSFRGLSGSELQLAL 734
gi 754401559  729 EENLEKCQIKNDELSQKV----SQYKEIEEIVEQKEHIVKingMDLDTRVQIWTKQFVALQSISGIKLLSLNDTILNVSF 804
gi 927374523  640 REAKAKLQKEIAEKEEIFKLVSTQLLEAQEEDKRLKKRVMelkLPSQNELDLLQQQFVDLQRTTQVELLVLNEKEFKVQI 719
gi 363749167  647 --GLEDLEKQRTIIRENKSKLHSQIAAVKKEIDSLKALLNrkkIHSSYDVKKLQNMFSQIQLFTGINFVKLVGSELHLSL 724
gi 367005480  598 --EYTTLKTKKEGLLLYVKEMNDKITSVRKEISALAADTMkgkVFTTYDISRLKMKFSLLQNITNVKFVSMVNSTLQIKL 675
gi 156848804  596 --QIKELQNKRNDVLTKISKTKESLSQTKLELENSNRAQRldsHFSEFELNRLKNRFSMFQTLSGIEFVSLKKSTLIVKS 673
gi 598073253  792 GNKIVDRTGELERINVKLADIGNKRTELVSELSQAQQVVQktkLNDKSEVIARHLTFKFLQQITKLQFVNEDNGVWEFIY 871
gi 448119595  908 KEVEMERQLRLEEISIKIQKNKELISTFNKDINEHEKIINdnrKYEKSEIEQLKTKYNMLQSITNLKYNSMKQNVISFTF 987
                         330       340
                  ....*....|....*....|
gi 74582228  1173 NNTaLspysaevTVEILRQN 1192
gi 74605655   656 HDDkV-------IVTADLSK 668
gi 74693054   735 NST-I-------NVSFDLTQ 746
gi 754401559  805 ASNmI-------TASIDLTK 817
gi 927374523  720 MKE-L-------QISVDLST 731
gi 363749167  725 KANkV-------NIGFDLLK 737
gi 367005480  676 NIKmFp------VINVEMRN 689
gi 156848804  674 PIEeFp------EIVIDLSK 687
gi 598073253  872 YQD-I-------KCRFDIKN 883
gi 448119595  988 YNT-L-------NIKMDFSD 999
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap