3D1J


Conserved Protein Domain Family
Glyco_transf_5

?
pfam08323: Glyco_transf_5 
Click on image for an interactive view with Cn3D
Starch synthase catalytic domain
Statistics
?
PSSM-Id: 337000
View PSSM: pfam08323
Aligned: 175 rows
Threshold Bit Score: 60.8064
Threshold Setting Gi: 122302306
Created: 26-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3D1J_A         3 VLHVSSEMFPLLKTGGLADVIGALPAAQIADGVDARVLLPAF-PDIRRgvtDAQVVSR---RDTFA-----G-------- 65
gi 81312455    3 IIQASVECAPFIKAGGLGDVVYSLSKALSIHH-DVEILLPFYpLLFPAf---sSQVLDehvFAYNFlgrqnAtatsy--- 75
gi 91206715    3 IIHTAIEFAPVIKAGGLGDALYGLAKALAANH-TTEVVIPLYpKLFTLp--kEQDLCSiqkLSYFFageqeAtafsy--- 76
gi 75127372  227 VVHVAVEMAPIAKVGGMGDVVTALARATQEDGHQVEVFVPHY-DIAQFe--NVDGYHr-------------Agefk---- 286
gi 75099261  150 IIHITAEMAPIAKVGGLGDVVTGLAKAALARGHFVTVMLPFY-ECLPKd--QIEGLKH---ECDIEvp--kGyrwdgeir 221
gi 122179513 423 IAHIAAEMAPVAKVGGLADVISGLGKALQKKGHLVEIILPKY-DCMQVd--QVSNLKV------LDvl--vQsyfe---- 487
gi 91206709    3 IVMITPECAPIAKVGGLGDVVQGLSNELSIRGNTVELILPKY-DCMRYe--RIWGLEK------THnn--lWvpyh---- 67
gi 122663364   3 IVQVASECAPVIKSGGLGDVVFGLSRELENQGHAVDVILPKY-DCMRYd--HISGLHQ------AYdd--lSvpwg---- 67
gi 61213457    3 IIHIASELAPLAKVGGLADVVLGLCRELSWKGHDVDIIIPKY-DCMDSe--QIRDLTV------DYfe--lPsfyn---- 67
gi 145354958 227 VVSVSVEMAPIAKVGGLGDVVTSLGLAVQAEGHKVEVVLPKY-DVLKYd--LIEDLKe-------------Eegfq---- 286
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3D1J_A        66 ----HITLLFGHYNGVGIYLIDAPH-----LYDrpGs-PYHDT-NlFAYTDNVLRFALLGWVGAEMASGlDpfW-R--PD 131
gi 81312455   76 ---------ryegmTLTVITLDSQLe----LFs--TstIYTE--------DDTLRFSAFSAAAAAYIQK------LdkVD 126
gi 91206715   77 ---------fyegiKVTLFKLDTQPe----LFe-nAetIYTS--------DDAFRFCAFSAAAASYIQKe-------gAN 127
gi 75127372  287 hektVVQVYKGWVEDVPVTLLRPENg----FFDvgC--IYGR----G---DDHVRFDFFTDATLTWLRS-K--QqE--VD 348
gi 75099261  222 vgplKTSVFWGRVQGCPVYLIKPADdtncnIFRggR--IYGGS---Y---NEMEAYLYFCRACLEYLNV-S--QqN--PH 288
gi 122179513 488 gnmfNNKIWTGTVEGLPVYFIEPQHpa--mFFSraQ--YYGE----H---DDFKRFSYFSRAALELLYQ-S--GkK--VD 551
gi 91206709   68 dqwiPCDVYFGFAEGLKCFFIEPHn----gFFQrgT--YYGQ----P---DDPQRFAFFCKAALEFMLR-S--NkY--PE 129
gi 122663364  68 ngsiRCTVLGGKVHGLNCFFIEPHSne--nFFNrgK--YYGD----N---DDNLRFAFFSRAVLEYMCM-H--NkR--PE 131
gi 61213457   68 gewfFNTVWMGWVENLKVYFIEPHHpr--fFFNrgC--FYGC----E---DDLERFLYFSRTALEFLYK-K--SiL--PD 131
gi 145354958 287 wggcYNHVFSGTVEGVKTYFIDPDNg----MFKvgM--IYGTDyL-EIPLTDAERFGYFSRAALEWMLQ-S--GrQ--PD 354
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3D1J_A       132 VVHAHDWHAGLApAYLAAR-GRP-----AKSVFTVHNLAYQGMFYAHHM-ND--IQLPW------SFF-NIHGLEFNG-Q 194
gi 81312455  127 VVHMHDWHVGLLaGLLKEPhLPSy----PKRIFTIHNFSYRGYCSTQLLgASeiSDFG---------LsNYQLFRDPS-T 192
gi 91206715  128 IVHLHDWHTGLVaGLLKQQpCSQl----QKIVLTLHNFGYRGYTTREILeASslNEFY---------IsQYQLFRDPQ-T 193
gi 75127372  349 VIHTHDWQTAAAtWAgy---------pnAATALTVHNLQFG--------------------------------------- 380
gi 75099261  289 VLQLHDWHAAAAsMLYWDV-YNPngfsrTRLMLTIHNLDNTGETRQDEF-FF--TGVPGenfatiDKAlDERTIGHNPeR 364
gi 122179513 552 IIHCHDWQTAFVaPLYWDV-YANlgfnsARICFTCHNFEYQGTAPARDL-AW--CGLDVehl-drPDRmRDNSH---Gr- 622
gi 91206709  130 IIHCHDWQTGLVpVLLFEQ-YKYlgmthPRVCYTLHNMRHQGVTGGHIL-QQ--VGLDPaay-mtPERlLDHTY---PhG 201
gi 122663364 132 IIHCHDWQTGLLpVMLFEQ-YKYrgmdgQRVCYTIHNFKHQGGGSVGIL-GA--TQLNNegyylsPDRlKDSSI---PnH 204
gi 61213457  132 IIHLHDWQTAVIaPLYKDM-YQKlgytkPKILFTIHNMEYQGKCAAHDL-NY--IGLDGnry-qqHSFmQDNLY---PhL 203
gi 145354958 355 IIHCHDWQTAPVaKVYWED-YHNyglgnPRVVFTIHNLDFG--------------------------------------- 394
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|.
3D1J_A       195 ISFLKAGLYYADHITAVSPTYAREITEPQFAY-GMEGLLQQ 234
gi 81312455  193 SVLLKGALYCSDYITTVSPSYAQDILNDY-SDyEIHDAIMS 232
gi 91206715  194 CVLLKGALYCSDFVTTVSPTYAKEILEDY-SDyEIHDAITA 233
gi 75127372  381 VDRIRRGMESCDIATTVSPTYADEVRF--------HHAIAP 413
gi 75099261  365 LNLMKGGIVYCNAVTTVSPTYANEVLN----G-GAAGWLRS 400
gi 122179513 623 INAVKGAIVYSNIVTTVSPTYALEVRS-EGGR-GLQDTLKV 661
gi 91206709  202 VNLMKGGIVFSNFITTVSPRYLDEIRYTDQGY-GLQHTLHE 241
gi 122663364 205 INFMKAGIVYSNAVNTVSPHHAWEARFSNEGY-GLGHTLAV 244
gi 61213457  204 INLLKGGIVYSDFVTTVSPNYAKEVLTPKEGR-GLEATLVE 243
gi 145354958 395 QSLIREAMDYSQIGTTVSRSYAQEISG--------HDSISH 427
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap