Conserved Protein Domain Family
Glyco_transf_5

?
pfam08323: Glyco_transf_5 
Click on image for an interactive view with Cn3D
Starch synthase catalytic domain
Statistics
?
PSSM-Id: 311982
View PSSM: pfam08323
Aligned: 175 rows
Threshold Bit Score: 59.6512
Threshold Setting Gi: 122302306
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3D1J_A         3 VLHVSSEMFPLLKTGGLADVIGALPAAQIADGVDARVLLPAFPDIRRgvtDAQVVSRRDtFA---G------------HI 67
gi 226711502   8 VLYVSGEISPFIRVSALADFMASFPHAMEEEGCEARIMMPKYGVINDrkfRLHDVLRLS------DievrskektdllHV 81
gi 122966436   6 ILYVASEINPFLQYSEVGKMLRKLPQAMQERGLEVRILIPRFGLINErknRLHEVVRLS------GinisvgeeekplII 79
gi 91206709    3 IVMITPECAPIAKVGGLGDVVQGLSNELSIRGNTVELILPKYDCMRYe--RIWGLEK---THnnlWvpyh----dqwiPC 73
gi 61213457    3 IIHIASELAPLAKVGGLADVVLGLCRELSWKGHDVDIIIPKYDCMDSe--QIRDLTV---DYfelPsfyn----gewfFN 73
gi 494514200   3 IVQVASECAPVIKSGGLGDVVFGLSRELENQGHAVDVILPKYDCMRYd--HISGLHQ---AYddlSvpwg----ngsiRC 73
gi 500032459   3 ILMVASECAPVAKVGGLGDVVHGLSRELHQRGHDVAVILPKYDCMRYd--HIWDLAI---SYenlWvpwn----ggviNC 73
gi 506233804   6 ILFVSSELVPYLPENEVSLMSYEAPRMVNSNGGQIRIFMPRYGNINErrhQLHEVIRLS------GmnlvindmdmplII 79
gi 492370922   7 VLFITQEITPYVSESEMSLVGRNLPQAIQEKGREIRTFMPKWGNINErrnQLHEVIRLS------GmnliiddtdhplII 80
gi 748608111   6 LLIVTHEMSPFLELTKISEITRQLPQAMQDKGFEIRILMPRFGNINErrnRLHEVIRLS------GmniiiddndnplII 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3D1J_A        68 TLLFGHYNGVGIYLIDAPH---LYDrpGsPYHDT--NlFAYTDNVLRFALLGWVGAEMASGlDpfW-RPDVVHAHDWHAG 141
gi 226711502  82 KVTALPSSKIQTYFLYNEK---YFKrnA-LFADMqqG-SDVKNSLERVVFFNLGVLETLQRlG--W-KPDIIHCQDWYAG 153
gi 122966436  80 KVASIPNAKLQVYFIDNED---YFQrkY-VFHDKa-N-KFYDDNDERAIFFCKGVMETVKKlG--W-APDIVHCNDWMTS 150
gi 91206709   74 DVYFGFAEGLKCFFIEPHn--gFFQrgT-YYGQ-----P---DDPQRFAFFCKAALEFMLR-S--NkYPEIIHCHDWQTG 139
gi 61213457   74 TVWMGWVENLKVYFIEPHHprfFFNrgC-FYGC-----E---DDLERFLYFSRTALEFLYK-K--SiLPDIIHLHDWQTA 141
gi 494514200  74 TVLGGKVHGLNCFFIEPHSnenFFNrgK-YYGD-----N---DDNLRFAFFSRAVLEYMCM-H--NkRPEIIHCHDWQTG 141
gi 500032459  74 TIWFGHVDGLASYFIEPHAeeqFFNrgT-YYGF-----W---DDAHRFGFFSRAALEFMLK-A--NlRPDIIHTHDWQTA 141
gi 506233804  80 KVASIPKERIQVYFIDNEE---YFKrkA-TFTDEn-G-ELFPDNDERAIFFAKGVVETVKKlN--W-APDIIHVHGWMAS 150
gi 492370922  81 KVASIQSARMQVYFIDNDD---YFq-nR-LQVTDenG-EEYEDNDARAIFYARGVLETVKKlR--W-CPDIIHCHGWMTA 151
gi 748608111  80 KVASIPAARMQVYFLDNED---YFQrkY-VFRDKe-D-KFYADNDERTIFFCKGALETVKKlG--W-APDIVHCHGWMTS 150
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3D1J_A       142 LApAYLAARGRP------AKSVFTVHN---------LAYQGMFYAHHMNDIQLPW------SFF-NIHGLEFNG-QISFL 198
gi 226711502 154 LVpLLLKTMYADceffkdIRTVLTVHNayrqgiyplKGFKKMLPSEVIDKMHVED------------------D-TVNML 214
gi 122966436 151 LIpLYLKTRYKLdpvfkdAKSVFTVHN---------NPIKFKFGKDLFSKVKMLD------IEDnMLSHLGSAD-YEGFI 214
gi 91206709  140 LVpVLLFEQYKYlgm-thPRVCYTLHN---------MRHQGVTGGHILQQVGLDPaay-mtPERlLDHTY---PhGVNLM 205
gi 61213457  142 VIaPLYKDMYQKlgy-tkPKILFTIHN---------MEYQGKCAAHDLNYIGLDGnry-qqHSFmQDNLY---PhLINLL 207
gi 494514200 142 LLpVMLFEQYKYrgm-dgQRVCYTIHN---------FKHQGGGSVGILGATQLNNegyylsPDRlKDSSI---PnHINFM 208
gi 500032459 142 LIpVMLYEIYESlgl-drQRVCHTIHN---------FKHQGTTGRDLLYATGLHRadyfgdVHCmGDDFT---PgAINHT 208
gi 506233804 151 LLpMYLRKVYADeplfadSKIVTSIYG---------VGFDGHLNKDLGKKIAFDK------VGDdNLSGLDNPT-YNNLL 214
gi 492370922 152 LApLYIKKAYKDepsfrdAKVIFSLYE---------DDFKQPFHADF----------------------------SNKLL 194
gi 748608111 151 LVpAYIKTSYKNdptfknSKVVYSIYE---------NCFEGNLNADLHKKAIMNA------MTAdDTKMFENAD-CNTMH 214
                        250       260       270
                 ....*....|....*....|....*....|....*..
3D1J_A       199 KAGLYYADHITAVSPTYAREITEPQFAY-GMEGLLQQ 234
gi 226711502 215 FTAVEHFDAVTTTSDAYAGMLADGRSEAfGLDRVIEK 251
gi 122966436 215 KMGLQYADAVIKTESDYTE----------SINKLFLE 241
gi 91206709  206 KGGIVFSNFITTVSPRYLDEIRYTDQGY-GLQHTLHE 241
gi 61213457  208 KGGIVYSDFVTTVSPNYAKEVLTPKEGR-GLEATLVE 243
gi 494514200 209 KAGIVYSNAVNTVSPHHAWEARFSNEGY-GLGHTLAV 244
gi 500032459 209 KGAITYANFVTTVSPKHAFEARHSDQGY-GLGHTLYR 244
gi 506233804 215 KVAVDHSDAVI--------------------LA---A 228
gi 492370922 195 LKGIAKKDI-----------------------AGLKE 208
gi 748608111 215 IGAVTYSDAVVLADENIHE----------DVLK---F 238
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap