Conserved Protein Domain Family
ASL_C

?
pfam08328: ASL_C 
Click on image for an interactive view with Cn3D
Adenylosuccinate lyase C-terminal
This domain is found at the C-terminus of adenylosuccinate lyase(ASL; PurB in E. coli). It has been identified in bacteria, eukaryotes and archaea and is found together with the lyase domain pfam00206. ASL catalyzes the cleavage of succinylaminoimidazole carboxamide ribotide to aminoimidazole carboxamide ribotide and fumarate and the cleavage of adenylosuccinate to adenylate and fumarate.
Statistics
?
PSSM-Id: 311987
View PSSM: pfam08328
Aligned: 239 rows
Threshold Bit Score: 102.878
Threshold Setting Gi: 609234967
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3BHG_A       335 RXQRDLSDSTVLRNLGVAFSYSLIAYHSVAKGNDKLQINKSALQKDLSEN-WEVLAEAIQTVXRRY--NEPNAYEQLKEL 411
gi 74951240  278 RMQRDLSDSSVLRNLGVAFAHSVVAYNSILSSLERMYFDESTSKLEIQEN-WNILSEPVQLNLKMM--GHMDAFEKVLVF 354
gi 156087609 337 RMQRDLSDSTVLRNVGVAFCHSYLAYLSILKAFSRISVNESRALEELDAN-WVVLSEPLQIHLRMT--GDASGYEKMLSL 413
gi 609234967 325 EHQRDLSNSASGRFTVEILAGFAAAVKRMVKILSGMTVNMKGLQRNLENAgSSVLAEPAYILLSSQ--GEADAHEIIRKF 402
gi 503102441 323 RLQRDLSDSTIKRNIGLGIGHVILGVRRLNTVLSSINVNEDAISRDLNEH-WEVLSEAVQVRLRAL--GMADAYERALAI 399
gi 257780667 329 RMQRDLSDSSAQRNIGAAIAYSYIAINSTLRGFRKISINPKTIEDDFEEA-WEVIAEAVQTVMRKH--GYCNPYERLKEI 405
gi 524152436 334 RMQRDLSDSSSQRNIGLAFGYSLQAISETTNGLAKCVVNKDKLAADLNEK-WEVLAEPIQTMLRKY--GISDAYDQLKEL 410
gi 749159579 383 RMQRDLSDSTVMRNLGMIFGYTTIAIKSIIVGIRRCDFNTHIALQELNNH-PELISEPIQCILRKYpkDIQDPYTLLKLI 461
gi 294944105  35 RMQRDLTDSTVQRAVGSAFAHTIIAIDSTIKGLSKVMVSAPIANRELEDH-WAVTGEAVQTVMRRY--GLERPYERLKEF 111
gi 401406536 262 RMQRDLSDSTVLRNVGVAFGHCLVAYESTKKGLGRVDVNRAAMLRELENH-WAVLGEPMQTVLRKR--GVRNAYEKLKSA 338
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*
3BHG_A       412 TRGQ---XIDAENLKKFIKTL--S-IPEEAK--AELXKLTPETYT 448
gi 74951240  355 TRGF---NPSKDEMLKFIEEN----CGKD----SRLLTLKLEEYl 388
gi 156087609 414 TRTG---CVSKETMKDIISDNcgN------N--TDLKSLTPSKYI 447
gi 609234967 403 TLKA---EQEEKSLSEVMKSD--KaVWEKIS--RRLEAvgvdnpd 440
gi 503102441 400 FRGS---RMGMEDYKKALGEL--G-VNDD-----ILRGLSPDKYV 433
gi 257780667 406 TRGK---MIGKEEIRAFISSV--E-LPEEDK--MRLMELSPQKYI 442
gi 524152436 411 TRGK---NISQEAIMEFAKGL--DvLSDEDR--QTLLDMTPASYI 448
gi 749159579 462 TRGKpndHDIRQHLNELLKTLqpI-LSQQDF--QFLSTINPQTYL 503
gi 294944105 112 TRGR---EIDATSMKEFTENIgrE-IGEDKPgvKGLENLTPQTYI 152
gi 401406536 339 TRGQ---AIDKERMQDIVEACgaDlLPEDV---DALRSLTPATYT 377
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap