Conserved Protein Domain Family
YscJ_FliF_C

?
pfam08345: YscJ_FliF_C 
Flagellar M-ring protein C-terminal
This domain is found in bacterial flagellar M-ring (FliF) proteins together with the YscJ/FliF domain (pfam01514).
Statistics
?
PSSM-Id: 312001
View PSSM: pfam08345
Aligned: 430 rows
Threshold Bit Score: 34.0911
Threshold Setting Gi: 0
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123766160   254 LNPLVGPGNVHAQASVEVDFARREETSEIY--------RPnqepgqaaVRSQQTSD---SRQTnas--paaGVPGAL-SN 319
10_pfamImport    1 LDRVLGPGNSTVQVTADLDFDKSVSESTTYgks---nkVP--------ALSSSTSTekyDGPAggs--sssGVVGPD-GQ 66
3_pfamImport     1 LQPLVGPGHVVVQVNAALNFDTKSTTSETYlqpspgttPI--------PLS---QSwsyETYSgtnq-aatGILGPDnIA 68
116_pfamImport   1 LEPIVGVGKAVVTVTADLDYDATERTQESFssa---egVL--------PLTERTTT---EEFAgggn-patGVLGPDnIQ 65
106_pfamImport   1 LDRILGNGMAVVSVTAELDFDATERVSESYdsn---edAL--------PLTERETT---EEYTgtg--naaGVLGPDnIA 64
203_pfamImport   1 LDRVIGPGRSAVTVTAELDFDESQRTTETFdat---kdTP--------PLA---SStktEEYTgtdq-tatGVLGPDeDV 65
191_pfamImport   1 LDPLVGPGRSAVTVTAEIDQSQTDRTVEEFtat---pdTP--------PLA---SStttETYTggaasgaaGVLGPDnIQ 66
254_pfamImport   1 LDRIAGPNNAVVTVRADLNFDKVDTTAESYdyt---agTP--------ALSESTTT---EGYTgsng-atgGVLGAEtpt 65
118_pfamImport   1 LDPILGPGRAKVSVRADVDLDQRSTTSETHtye---egTP--------PISESTTT---EEYTgnga-avgGILGPEnqa 65
236_pfamImport   1 LDQVVGAGNAVVSVRADVDLSQRNTTTETYdfq---egTP--------PISEQTTT---ETYEggga-pvgGILGPE--N 63
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123766160   320 QPpaatqapltnppapaqpqaqpaapqqaaqisGNERRDATINYEVDRTISHVKQPVGQVKRLSVAVVVNhlpnkdgdPQ 399
10_pfamImport   67 MDsfgatg--------------------aggksSYVKESTTSDNAVEKTIEHRETAPGSINTLHVGVVLDtt-----aAQ 121
3_pfamImport    69 VPtpsp------------------------spgTYQSQSATVDNAIGRVVEEVKTAPGSVERLSVAVLLD--------SA 116
116_pfamImport  66 VPngt-------------------------adgSYTNETSEANNAVDKLTEHTVTAPGTVRRQSVAVAVD--------AA 112
106_pfamImport  65 VPegq-------------------------tdgNYTNTSSERNNAVDKTTERIVTAPGTVRRQSVSVAVD--------QQ 111
203_pfamImport  66 VGpdgt-----------------------gqggAYKSTSEDVTNAINKTTEVVKAAPGAVQRQSIAVVVD--------SE 114
191_pfamImport  67 VPngdgt----------------------tgegSYESTTEDVTNAVNKSTERTTQGPGAIQRQSVAVVLD--------EK 116
254_pfamImport  66 tg--------------------------gtgdsTYDKSSTTSNNAVGKTVTTTEGAVGTVDRLTVSVAMD--------SA 111
118_pfamImport  66 dag------------------------ggtgdsAYNKESTTANNAVGTTVETVEGAPGRINRLTVSVVMD--------EA 113
236_pfamImport  64 MPdaaena--------------------gggesNYEKESTTANNAVGKTVEVVEGAPGALRRLTVSVVMD--------DA 115
                          170       180       190
                   ....*....|....*....|....*....|....*
gi 123766160   400 ALPPEELSKLTTLVREAMGYSEARGDSLNLVNSQF 434
10_pfamImport  122 TVNPTD---VQDLIAATVGINPDRGDTVQVTTMPF 153
3_pfamImport   117 AAKNVNLTDVKNLVTSAAGVQTSRGDSVSVATMPF 151
116_pfamImport 113 AAAAVDMAQLQAMVSSASGFDEARGDVVTVSQMPF 147
106_pfamImport 112 AAATININDLQAMVTAAAGIDEERGDTVTVTRMAF 146
203_pfamImport 115 AAAGLDLTELQATVAAAAGVDTTRGDTLALQAAAF 149
191_pfamImport 117 AAAPIDLAQLRETIAAAAGIDPERGDTIAVQAVPF 151
254_pfamImport 112 TAGGVDQVQLQNLVSNAVGLDTARGDAITVASMAF 146
118_pfamImport 114 VAGNLNQAQIQALVGNAIGLDVARGDDITVASMAF 148
236_pfamImport 116 VAGNLNQQQMTELMTNAVGLDQARGDEITVAAMPF 150
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap