Conserved Protein Domain Family
PAS_6

?
pfam08348: PAS_6 
YheO-like PAS domain
This family contains various hypothetical bacterial proteins that are similar to the E. coli protein YheO. Their function is unknown, but are likely to be involved in signalling based on the presence of this PAS domain.
Statistics
?
PSSM-Id: 312004
View PSSM: pfam08348
Aligned: 215 rows
Threshold Bit Score: 87.5478
Threshold Setting Gi: 504036920
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122480621   11 LESYIPLVQFFGKVCGGNYEIVLHDASNPDESIIAIANEHISGRKLGGPMTDLALKLIKGEYYKEQDYIvNH-GRTKD-N 88
gi 503041582    9 LKTYIPLVDFIAGIVGPFCEVVLHDVSNVESSIVAIKNNHISGRQVGGPLTDLGLKLLKEKAYVEKDYLlNYpGKTKD-G 87
gi 503543217    9 LKAYIPLVDFIAGIVGPNCEVVLHDCSNVDESIIAIKNNHISGRKVGGPLTDLGLKLLKEGSYKKKNFLlNYpGKSSD-G 87
gi 502572172    8 LESYFPIASFIAAIIGPQCEVVVHDISDPERSIIFIENGHISGRRVGDASTDLVLKILKAEAYREEQFIaNYkASGAR-G 86
gi 502632590    7 IKMVKPMVDFLAEVLGDLAEVVLHDLRDPEHSIVAIRNGHISGRNVGDSLTDYALEILRESKDLP--YKvNYkGLLDD-G 83
gi 493344856   10 LRFARPLVDFLGDVMGEDCEVVLHDLRDPERSILAIRNGQVTGRSVGDSVTDYALEVLRESQ--GQDYRaHYpGRLAEgG 87
gi 1024297054  12 vREFIPFVDFLADILGPSSEVVLNDLLDLNHSVVAIRNSHISHRQVGDPATDLALRTMKAGKAEKRDYLaNYkGVSQG-K 90
gi 408466280   11 LQLFVPLVDFLGKILGPKTEVVLENVKDFSHSVVAIANGNLSGRAIGSPATDLVLHIWQNREYDRHDYLtHYaGYTIQ-G 89
gi 524274490    5 vRRFLPMVDFLEQILGKNSEIVLHDFSDPDHAIVDIRNGIVSGRKVGGPATDLALKIMHDAKYRDLPFItGYeGRGAG-G 83
gi 504834722    8 LEEVFPLAEFIADSFGPMAEIVVHDITRPENSIVFIRNGQLSGRSLGDGITDQTLQLAIRADQDGADFVsDYrGRRLN-K 86
                          90       100       110
                  ....*....|....*....|....*....|...
gi 122480621   89 KILVSSTFFIKGKNHDLIGLLCINNNVTELMAF 121
gi 503041582   88 KVLRSSTFFIKDEDGDIAGMLCVNMDLSAAYAA 120
gi 503543217   88 RKLRSSTYFIKDEKNELIGMLCINIDLTDALAA 120
gi 502572172   87 QTFRSSTYFIKNGSGELVGLMCLNIDITHMEVA 119
gi 502632590   84 RPIRLSSFFIRDPSGEPVAMLSINLDISRVQDA 116
gi 493344856   88 KALRLSSLFLRDDEGRIVGMLSLNQDLSRLREA 120
gi 1024297054  91 HSLRSSTYFLR-LDGEIVGMICINTDDSALDDL 122
gi 408466280   90 HPVVSSTLFVRNSRGRVIGFLCINFDNSTFRQA 122
gi 524274490   84 KTLESATYFIR-ENDEIVGMLCVNTDLSTVRSI 115
gi 504834722   87 HEFRVSSYLVRNLEQTVIGLLCISINITELQQA 119
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap