Conserved Protein Domain Family
PAS_6

?
pfam08348: PAS_6 
YheO-like PAS domain
This family contains various hypothetical bacterial proteins that are similar to the E. coli protein YheO. Their function is unknown, but are likely to be involved in signalling based on the presence of this PAS domain.
Statistics
?
PSSM-Id: 337016
View PSSM: pfam08348
Aligned: 214 rows
Threshold Bit Score: 88.3191
Threshold Setting Gi: 504036920
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123655949  22 TLQMLGSVVGRHVEIVLHDLDRPECSIVAIANGHVTGRRVGDPVlvgprQDLGFAAVRRALQDrsaaTPLVLENYPTLAP 101
gi 504864396  11 IVEGLGKTLGRNCEIVLHDISNPDSSIIAIANGHVTGRNIGSPA-----TDFLLDLAAAP--N----ENDMVINYFTKAS 79
gi 502572172  14 IASFIAAIIGPQCEVVVHDISDPERSIIFIENGHISGRRVGDAS-----TDLVLKILKAEAYR----EEQFIANYKASGA 84
gi 493828083  17 LVDFLGEVLGENAEVVLRDCRKPDHDIIAIANGHVSGRTIGAPI-----TDFTLSILANEEWK----EKDYVVNYEGKAA 87
gi 503127919  13 FTKFLGNFLGPNYEVVLHDVTTPEKSVIAIENSHVSGRGIGSPL-----TDLSLKILQDKLYL----KQDYISNYISITA 83
gi 341821657  10 IVPFLGAALGKDCEVVLHDLRHPEESVIAIANGDISSRKLGAPA-----TDFILKLMQVGKKR----DQEYMTNYYGKSI 80
gi 656221451  13 VAKFISEILGDNCEVVIQDITTPNNSIIFIKNGHLTGRNIGSPL-----TNLVFNIIQNKTYT----NKNYAANYKAVG- 82
gi 489632518  11 MIEFLGKALGDNVEIALHDLTSKEQEIVAIANNHNSGREVGAKL-----SNLSLHYLEEKQYL----DNDYVMNYKTTGP 81
gi 524723824  11 LVPFLGVALGDNVEIALHDLTSPEQEVVAIANGEISGREIGAKL-----SNLSVHYLETKQYE----KSDYVMNYKTAGP 81
gi 504834722  14 LAEFIADSFGPMAEIVVHDITRPENSIVFIRNGQLSGRSLGDGI-----TDQTLQLAIRADQD----GADFVSDYRGRRL 84
                         90       100       110
                 ....*....|....*....|....*....|....*....
gi 123655949 102 DGRELRSSTVIFRDSSGQ-PFASLCSNSDLSGIAAAHAC 139
gi 504864396  80 NGKQLKSSTFLLRDEKGE-VIGALCINIDISQLLGVKDF 117
gi 502572172  85 RGQTFRSSTYFIKNGSGE-LVGLMCLNIDITHMEVAADw 122
gi 493828083  88 PDKRLRSSTYFIR-EEGK-LVGQLCVNIDMTPYEQVMDr 124
gi 503127919  84 SGDQVKSATYFIKDVNNN-LIGLLCINMDANKLLDMQAI 121
gi 341821657  81 NGHTLRSSTFFIHDEDDN-IIGALCLNYDVQHYLDVRKQ 118
gi 656221451  83 NFKTFKSSSYFIKNDDNK-IIGLLCVNIDVEPYNKVKDL 120
gi 489632518  82 DGKLMRSATYFIKEPGKEmPVGMLCINVNISDLEYLtst 120
gi 524723824  82 DGKLLKSATYWIKEPGNVyPVGMLCINVNVTDFEYIETA 120
gi 504834722  85 NKHEFRVSSYLVRNLEQT-VIGLLCISINITELQQAAHV 122
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap