4C0L,5KSZ


Conserved Protein Domain Family
EF_assoc_2

?
pfam08356: EF_assoc_2 
Click on image for an interactive view with Cn3D
EF hand associated
This region predominantly appears near EF-hands (pfam00036) in GTP-binding proteins. It is found in all three eukaryotic kingdoms.
Statistics
?
PSSM-Id: 337021
View PSSM: pfam08356
Aligned: 80 rows
Threshold Bit Score: 107.943
Threshold Setting Gi: 410082724
Created: 25-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4C0L_A        45 TPLQPQILDEVKAVIQKNVPDG-IYNDAVTLKGFLFLHCLFIQRGRNETTWAVLRRFGYNDQLEMCQEYLRPPLKIPPGS 123
gi 121937751 221 KPLSPTELHNIKAAVNKAAPTS-NTENGLDLYAFLQLNKLYAEKGRHETIWIILRKHHYTDSLSLEDGFLRPRFEVPDYA 299
gi 913856474  11 KPLTSEDLDNIKQSVSKAAPET-SAEKGIDKLGFLQLNKLYAEKGRHETIWIILRKFNYTDSLSLEDSFLHPKFEVPEYS 89
gi 589109365 221 KPLTDDDLDNIKLSISKSLRGAvDLSKGIDLKGFVQLNKMYAEKGRHETIWIILRKFHHTDSLSLEENFLHPKFEVPEFC 300
gi 629689023 220 KPLTSDDLDNIKLSISKSMPDA-NMERGIDQSGFLQLNKIYAEKGRHETIWIILRKYHYTDSLSLEDKFLHPRFDVPEYC 298
gi 171682442 220 KPLLPGELENLKAVVSKAVPTC-DISKGLDLQCFLQLNKLYAEKGRHETIWIILRKHHYTDSLSLEDGFLQPKLDVPEYA 298
gi 576041836 223 KPLPPEELDNIKRTVSKAVPTS-SVEKGLDMRGFLYLNKIYAEKGRQETIWIILRKHHYEDSLCLEDSFLHPRFDVPEFS 301
gi 336260109 221 KPLSQEDLDNIKLTVSKAVPSS-STDKGLDLQGFLQLNKLYAEKGRHETIWIILRKYHYTDSLSLEDNFLHPRFDVPDNA 299
gi 389640531 227 KPLKPEELENIKTTIAKAIPGS-RIDLGVDLPGFLQLNKLYAEKGRHETIWTILRQYHYTDSLSLQDSFLHPKFDVPEYA 305
gi 631237096 229 KPLSADDLENIKLTISRSTPEA-NTEKGVDLAGFLQLNKIYAEKGRHETIWIILRKYHYDDSVSLEDGFLHPKFDVPEYA 307

                 ....*...
4C0L_A       124 STELSHRG 131
gi 121937751 300 SAELSPAG 307
gi 913856474  90 SAELSPAG 97
gi 589109365 301 SAELSPAG 308
gi 629689023 299 SAELSPIG 306
gi 171682442 299 STELSPAG 306
gi 576041836 302 SAELSPAG 309
gi 336260109 300 SAELSPAG 307
gi 389640531 306 SAELSPAG 313
gi 631237096 308 SAELSPAG 315
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap