4JYK


Conserved Protein Domain Family
TetR_C_3

?
pfam08362: TetR_C_3 
Click on image for an interactive view with Cn3D
YcdC-like protein, C-terminal region
This family comprises proteins that belong to the TetR family of transcriptional regulators. They bear particular similarity to YcdC, a putative HTH-containing protein. This family features the C-terminal region of these sequences, which does not include the helix-turn-helix.
Statistics
?
PSSM-Id: 312013
View PSSM: pfam08362
Aligned: 16 rows
Threshold Bit Score: 208.307
Threshold Setting Gi: 81856205
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4JYK_B       70 LRQILDIWLAPLKAFREDFAPLAAIKEYIRLKLEVSRDYPQASRLFCMEMLAGAPLLMDELTGDLKALIDEKSALIAGWV 149
gi 81820059  65 LAELLDTWLDPLRALDEQGEPLTELLAYVHRKLEMSRDYPRESRLFANEIVQGAPRIYQALSEDLKVLVDDKVALLEGWM 144
gi 81857257  59 LDSIVEPLLEASRPFAGDQPPAEALRAYVDNKMRIGAERPYAARVFSCEIMRGAPRMPAPLLERLDAQAERNAERIRQWI 138
gi 81857286  59 LESIVEPLLQASAPFRVEDDPLLALPAYIRSKIRISRELPHASKVFASEIMHGAPHLPKEYLDELNAQAQRNVTCLQTWI 138
gi 81840480  59 LESIIAPIMQASTPFNADGDPKEVLSAYIRSKIRISRDLPHASKVFASEIMHGAPHLSPNQVEQLNEQARHNIECIQRWI 138
gi 81840064  59 LESIIEPILRASTPFNPQGVPAEVLSRYIRSKIEISRDLPFASKVFASEIMHGAPHLTPEQIEQLNGQARHNIECIQAWI 138
gi 81840330  72 LSNIIDLWDSTFNNLSVDDDPAEALARYIRAKMEFSRRQPQASRIFAMEIISGGECMSEYFSQDYRLWFQGRAAVFQAWI 151
gi 81824596  89 LDDLLEDWHAAADSFDVGDDPVAALGGYVRAKMALSRERPLGSKVWANEIISGATHMQDLLLERVKPWMDTRIALIERWI 168
gi 81857393  63 LLGLLEVWKQDALCFEMFDDPRVVLTSYIRAKMNHSRTRPHGSKVWANEIMHGAPLLGATLDDSLYEWAKMKEAKIRQWV 142
gi 81827566  60 LTTVLQKWLAPLQTLEVELEPTEALAHYLIQKIEVSRTQPKASKLFALEIIQGAPHILEILKGPLKKLFKRKAKVIQTWQ 139
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|...
4JYK_B      150 KSGKL-APIDPQHLIFMIWASTQHYADFAPQVEAVTGATLRDEVFFNQTVENVQRIIIEGIRP 211
gi 81820059 145 AAGRI-ARVHPYHLLFSIWSLTQHYADFDVQVRAVLG----DEDPFDGADVFLDTLYRRLLSP 202
gi 81857257 139 DEGLL-APLDPYHLLLNLWAMTESYALGGWQLARLTGQAGLDASDYRQAAENIVRLVCAGCLA 200
gi 81857286 139 DRGQL-APVDPHHLLFAIWAATQTYADFDWQISIVTGKEQLSDADYDAAVETITRLVLKGCTP 200
gi 81840480 139 DRGQI-AHVDAHHLMFSIWAATQTYADFDWQISAVTGKAKLADSDYDAAAETIIRMVLKGCEP 200
gi 81840064 139 DKGLI-AALDPHHLMFTIWAATQTYADFDWQIATVTGKAKLDDADYEAATQTILRLVLKGCEP 200
gi 81840330 152 DAGKM-DPVDPVHLIFLLWGSTQHYADFASQICRVTGRSRLTRQDMDQASNNLIRIILKGCGL 213
gi 81824596 169 ARGLV-EPVEPKTLLYMIWATTQHYADFDAQIVALSGKHGLSAKAFDATTDEVVRLILRACGA 230
gi 81857393 143 EEKRI-LSIEPSSLLYMIWASTQHYADFGYQVEVLNGHQPLSDMQFERAVQTVTSVVLRGIGL 204
gi 81827566 140 EQGKIsADIDPELLILNIWAITQNYADFSIQMEMVTGKTLKNKSMHQRAIEHTVHMMLYGVIP 202
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap