Conserved Protein Domain Family
PDR_assoc

?
pfam08370: PDR_assoc 
Plant PDR ABC transporter associated
This domain is found on the C-terminus of ABC-2 type transporter domains (pfam01061). It seems to be associated with the plant pleiotropic drug resistance (PDR) protein family of ABC transporters. Like in yeast, plant PDR ABC transporters may also play a role in the transport of antifungal agents [pfam06422]. The PDR family is characterized by a configuration in which the ABC domain is nearer the N-terminus of the protein than the transmembrane domain.
Statistics
?
PSSM-Id: 312020
View PSSM: pfam08370
Aligned: 185 rows
Threshold Bit Score: 54.0209
Threshold Setting Gi: 0
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                            10        20        30        40        50        60
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 857216051    738 WNRLVQ---GTNTTLGIEVLKSRGMFTEAKWYWIGVGALFGYVIVFNILFTIALGYLKPSGKAQQIL 801
57_pfamImport     1 WMRPNPs--NPGSTLGIDVLQFRGFPTEYWWTWASVGFVLASLALLLLLFIATMTFIGAPRQRRTI- 64
118_pfamImport    1 WNMKTEngeSTGDTVGKTILRSRGMLTEWHWFWYSVMILLLFALVFNILSIFALEYLRAPQKSRS-- 65
98_pfamImport     1 WATVFHf--EDVNTTGEAVLKFRGLINEWHWYWVCVGVLFGFSLIFNLISIFALEFLNSPQEHH--- 62
89_pfamImport     1 WGKEFHy--ENANTIGEAILKIRGLFIEWQWYWICLSVLFGFSVVFNILTIFALEFLNPPYKQKVSI 65
174_pfamImport    1 WAKEFHf--ENAKTIGEAILKVRGLLGEWQWYWICVVVLFGFALIFNILSILALEFLNSPHKHQSNI 65
170_pfamImport    1 WATEFHy--ENDNTIGEAILKIRGFLTESHWYWICVGILFGFALVFNVLSIFALEFLNSPHKRKV-- 63
114_pfamImport    1 WNSEFYy--NGANTVGEAILKIRGLLMEWHWYWICVTILFGYSLVFNIFSIFALEFIGSPHKHQVNI 65
127_pfamImport    1 WAIEFHy--ANAKTVGEAILKIRGLLMEWHWYWICVGILFGFSLVFNILTIFALEFMKSPHKHQVNI 65
171_pfamImport    1 WATELYy--ENAKTVGVAILKIRGLLTEWHWYWISVIILFGFSIVFNILTISALEFMNSPHNHQVKI 65
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap