Conserved Protein Domain Family
PDR_assoc

?
pfam08370: PDR_assoc 
Plant PDR ABC transporter associated
This domain is found on the C-terminus of ABC-2 type transporter domains (pfam01061). It seems to be associated with the plant pleiotropic drug resistance (PDR) protein family of ABC transporters. Like in yeast, plant PDR ABC transporters may also play a role in the transport of antifungal agents [pfam06422]. The PDR family is characterized by a configuration in which the ABC domain is nearer the N-terminus of the protein than the transmembrane domain.
Statistics
?
PSSM-Id: 337027
View PSSM: pfam08370
Aligned: 178 rows
Threshold Bit Score: 60.6017
Threshold Setting Gi: 674874885
Created: 29-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 75326884    738 WMNKMS--GNSTTRLGTSVLNIWDVFDDKNWYWIGVGGLLGFTVIFNGFFTLALTYLDPLGKAQA 800
gi 1002866488  634 WGKEFH--YENANTIGEAILKIRGLFIEWQWYWICLSVLFGFSVVFNILTIFALEFLNPPYKQKV 696
gi 1162490034  625 WAKVFY--FKNSKTLGEAILMLRGLLNEWQWYWTCIGILFGFTLVFNILSVLALHFLKSPHKREV 687
gi 514728471   636 WATVFH--FEDVNTTGEAVLKFRGLINEWHWYWVCVGVLFGFSLIFNLISIFALEFLNSPQEHHl 698
gi 586761371   727 WEEITY----ANMSVGQQTLRSRGLLFEGSLYWVAVGALFCLTILYNIGFTLALRYLNSPDNSHA 787
gi 1149751315  655 WASEFY--YANAKTVGEAILKIRGLLTEWHWYWICVGILFGFSLVLNILTIFALEFMNSPHKHQV 717
gi 1142693931  617 WNSEFY--YNGANTVGEAILKIRGLLMEWHWYWICVTILFGYSLVFNIFSIFALEFIGSPHKHQV 679
gi 475588628   202 WATEFH--YENANTIGEAILKIRGFLTESHWYWICVSVLFGFALVFNILSIFALEFLNSPHKREV 264
gi 1149811746  621 WAKEFH--FENAKTIGEAILKVRGLLGEWQWYWICVVVLFGFALIFNILSILALEFLNSPYKHQG 683
gi 694996296   642 WNMKTEngESTGDTVGKTILRSRGMLTEWHWFWYSVMILLLFALVFNILSIFALEYLRAPQKSRS 706
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap