Conserved Protein Domain Family
MAP2_projctn

?
pfam08377: MAP2_projctn 
MAP2/Tau projection domain
This domain is found in the MAP2/Tau family of proteins which includes MAP2, MAP4, Tau, and their homologs. All isoforms contain a conserved C-terminal domain containing tubulin-binding repeats (pfam00418), and a N-terminal projection domain of varying size. This domain has a net negative charge and exerts a long-range repulsive force. This provides a mechanism that can regulate microtubule spacing which might facilitate efficient organelle transport.
Statistics
?
PSSM-Id: 312025
View PSSM: pfam08377
Aligned: 4 rows
Threshold Bit Score: 1636.26
Threshold Setting Gi: 620945528
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 215274255  377 DKMAEAPPSEAMTLPKDAHIPVVEEHVMGK--VLEEEKEAINQEtvqQRDTFTPSGQEPILTEKETELKLEEKTTISDKE 454
gi 672065475  460 DKVADVPVSEATTVLGDVHSPAVEGFVGEN--ISGEEKGTTDQE---KKETSTPSVQEPTLTETEPQTKLEETSKVSIEE 534
gi 884928300  457 DKVAEAAASEAITLPTDAHVPVVEESVTEK--GLGEETGVTPQE---KTEISTLSGQEPALAGRELQPKLEEKTSISDKE 531
gi 620945528  306 DKMGDMPMSTVITQSMEVHKLTIRESHGQRgcGVGEDKDIPRWEndlRKEHFLPNGQKFALFESEPYRKPEEKSSVLV-- 383
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 215274255  455 AVPKESKPPKPADEEIGIIQTSTEHTFS--EQKDQEPTTDMLKQDSFPVSLEQAVTDSAMTSKTLEKAMTEPSALIEKSS 532
gi 672065475  535 TVAKEEESLKLKDDKAGVIQTSTEHSFSkeDQKGEEQTIEALKQDSFPISLEQAVTDAAMATKTLEKVTSEPEAVSEKRE 614
gi 884928300  532 AVPKEHEPSKLRDEETGIIQTATEHTFLqeEPKSQEHATDMLKQDSFPASLEQAMTDPTMISNTLEKVSIEPAALHEKST 611
gi 620945528  384 SLPQDSKLLKGLDEEKSTTRSLGGQTIKkeEPPSKGAQVDQFRRDSFPGAQGRDLMLAAALSETLDKMPVAPSPRSDPA- 462
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 215274255  533 IQELFEMRVDDKD-KIEGVGAATSAELDMPFYEDKSGMSKYFETSALKEEATKSIEPGSDYYELSDTRESVHESIDTMSP 611
gi 672065475  615 IQGLFEEDIADKS-KLEGAGSATVAEVEMPFYEDKSGMSKYFETSALKEDVTRSTGLGSDYYELSDSRGNAQESLDTVSP 693
gi 884928300  612 LQELFQEKVADKDsKVEGVGAAQSTEIDMPFYEDKSGMSKYFETSALKEEVTKSIQLASDYYELSDTRESAPESVESIST 691
gi 620945528  463 -RSLSQEREIGKDiRADKAGAPPPTE-ERPLDEDKSGMSKYFETSTLKEEATKSLQQDSDYYELSDSKESAYESYDTVAP 540
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 215274255  612 MHKNGDKEFQTgKESQPSPPAQEAGYSTLAQSY----PSDLPEEPSSPQERMFTIDPKVYGEKRDLHSKNKDDLTLSRSL 687
gi 672065475  694 KNQQDEKELLA-KASQPSPPAHEAGYSTLAQSYtsdhPSELPEEPSSPQERMFTIDPKVYGEKRDLHSKNKDDLTLSRSL 772
gi 884928300  692 MREDGDKGSQAeKEPQPSAPAQEAGYSTLAQSY----PAEVPEEPSSPQERMFTIDPKVYGEKRDLHSKNKDDLTLSRSL 767
gi 620945528  541 MFKDGDQES--------SAPACEVGYSTLAQGY----PSDIAEEPSSPQERMFTIDPKVYGEKRDLHSKNKDDLTLSRSL 608
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 215274255  688 GLGGRSAIEQRSMSINLPMSCLDSIALGFNFGRGHDLSPLASDILTNTSGSMDEGDDYLPATTPALEKAPCFPV------ 761
gi 672065475  773 GLGGRSAIEQRSMSINLPMSCLDSIALGFNFGRGHDLSPLASDILTNTSGSMDEGDDYLPPTTPAVEKIPCFPI------ 846
gi 884928300  768 GLGGRSAIEQRSMSINLPMSCLDSIALGFNFGRGHDLSPLASDILTNTSGSMDEGDDYLPATTPAVEKAPCFPI------ 841
gi 620945528  609 GLGGRSAIEQRSMSINLPMSCLDSIALGFNFGRGHDLSPLASDILTNTSGSMDEGDDYLPATTPGLEKAPGFPTegreek 688
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 215274255  762 ----------------------ESKEEE-QIEKVKATGEESTQAEISCESPFLAKDFYKNGTVMAPDLPEMLDLAGTRSR 818
gi 672065475  847 ----------------------ESKEEEdKTEQAKVTGGQTTQVETSSESPFPAKEYYKNGTVMAPDLPEMLDLAGTRSR 904
gi 884928300  842 ----------------------ESKEEEeKLEEEKTTGGENTQVEAPCESPFVAKDYYKNGTVMAPDLPEMLDLAGTRSR 899
gi 620945528  689 eeegeeeeeeeeeeeveeaeqaEGQKKAgKAVEV-----ESSQVESPSESPFLAKEYYKNGAVMAPDLPEMLDLAGTRSR 763
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 215274255  819 LASVSADAEVARRKSVPSETVVEDSRTG-LPPVTDENHvIVKTDSQLEDLGYCVFNKYTVPLPSPVQDSENLSGESGTFY 897
gi 672065475  905 LASVSADAEVARRKSVPSEAVVAESSTG-LPPVADDSQ-PVKPDSQLEDMGYCVFNKYTVPLPSPVQDSENLSGESGSFY 982
gi 884928300  900 LASVSADAEAARRKSVPSETVIEESSTG-LPPVTDENHvIVKTDSQLEDLGYCVFNKYTVPLPSPVQDSENLSGDSGSFY 978
gi 620945528  764 LASVSADTESARRKSVPADVGGHDSGAGvLSPIGNKNHvAVKDDSQMEDLGYCVFNKYTVPLPSPVQDSENLQGDSGLFY 843
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 215274255  898 EGTDDKVRRDLATDLSLIEVKLAAAGRVKDEFSVDKEASAHISGDKSGLSKEFDQEKKANDRLDTVLEKSEEHADSK--- 974
gi 672065475  983 EGTDDKVRRDLATDLSLIEVKLAAAGRVKDEFTAEKEASPPSSADKSGLSREFDQDRKANDKLDTVLEKSEEHVDSK--- 1059
gi 884928300  979 EGTDDKVRRDLATDLSLIEVKLAAAGRVKDEFGAEKETSP-----TSGLLREFDQERKGNDKLDTVLEKSEEHADAK--- 1050
gi 620945528  844 EGADDKLRRDLATDLSLIEVKLAATGRVKQDVGGEKEPSPPVSGDKAGLSRELDQDRKATDKLDTVLEKGEEPMDSKetl 923
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 215274255  975 ---EHAKKTE-EAGDEIETFGLGVTYEQALAKDLSIPTDASS---EKAEKGLSSVPEIAEVEPSKKVEQGLDFAV----Q 1043
gi 672065475 1060 ---EHAKESE-EVGDKVELFGLGVTYEQTSAKELITTKETAP---ERAEKGLSSVPEVAEVETTTKADQGLDVAAkkddQ 1132
gi 884928300 1051 ---EHAKEAQ-EAGATVDMFGLGVTHTEPSAKELTASKDAAS---EKAEKGLSSVPEVAEVEPSKKTEHELDFAAtkadE 1123
gi 620945528  924 lpeEHGKLGPgEVVTKVEMVSSEPAVDLASIQVMTQSQDTSPfmtEKVEPLLGSVPEVAETEPLPKAEPRTDPSAkadpS 1003
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 215274255 1044 GQLDVKISDFGQMASGLNIDDRRATELKLEATQDMTPSSKAPQEADAFMGVESGHMKEGTKVSETEVKEKVAKPDLVHQE 1123
gi 672065475 1133 SPLDIKVSDFGQMASGMSVDAGKTIELKFEVDQQLTLSSEAPQETDSFMGIESSHVKDGAKVSETEVKEKVAKPDLVHQE 1212
gi 884928300 1124 APLDVKISDLGPIMARLDVDAREIAELTLEVQQEQVPPSEAPREADVFLGVEAGHLKDGARVSETEVKEKVAKPDLVHQE 1203
gi 620945528 1004 QPV-VQVSDFGSTAAEQDGASQGPA-----AQQEGAGLARGGQDVELLVGAEAGDGKEGTRGSEAEIKEKVAKPDLVHQE 1077
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 215274255 1124 AVDKEESYESSGEH----ESLTMESLKADEGKKETSPESSLIQDEIAVKLSVEIPCPPAVSEADLATDERADVQMEFI-Q 1198
gi 672065475 1213 AVDKEESYESSGEH----ESLTMESLKPDEGKKETSPETSLIQDEVALKLSVEIPCPPPVSEADSSIDEKAEVQMEFI-Q 1287
gi 884928300 1204 AVDKEESYESSGEH----ESLTMESLKPDEGKKETSPESSLIQDEIALKVSVEVPCPPAVSEADLAAQEPADVQMESIpT 1279
gi 620945528 1078 AVDKEESYESSGEHdvtpEGGAGEPSKPDEGKKEPAKEPPTLPDEVTVR-ALEAELPP--SSVDAVLVEGADIQMEPI-Q 1153
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 215274255 1199 GPKEESKETPDISITPSDVAEPLHETIVSEPAEIQSEE-----EEIEAQGEYDKLLFRSDTLQITDLGVSGAREEF---- 1269
gi 672065475 1288 LPKEESTETPDIPAIPSDVTQPQPEAVVSEPAEVRGEE-----EEIEAEGEYDKLLFRSDTLQITDLLVPGSREEF---- 1358
gi 884928300 1280 LPKEDSRETPDIAVTASDVPEPQPEAAMAQPAEVQSEE-----EEIEARGEYDKLLFRSDTLQITDLGAPSSRENV---- 1350
gi 620945528 1154 QPKRDSQEAPGISITPSEALEP---TLLKPGSEASADEnkegqEEVEARGESDRLLFRSETLQLADLSIPTDREESekrg 1230
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 215274255 1270 VETCPSEHKGVIESVVTIEDDFITVVQTTTDEGESGSHSVRFAALEQPEVERRPSPH----------------------- 1326
gi 672065475 1359 VETCPGEHKGVVESVVTIEDDFITVVQTTTDEGELGSHSVRFAAPVQPEEERRPYPH----------------------- 1415
gi 884928300 1351 LETCPGERKGGIESVVTIEDDFITVVQTTTDEGESGSHSVRFAALEQPEMERRPSPQ----------------------- 1407
gi 620945528 1231 VEDVP-EHKGGIESVVTIEDDFITVVQTTTDDGESGSHSVRFAALDQAEVESRPSPPggeeeeeeeeeeeeeggggggge 1309
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 215274255 1327 -----DeEEFEVEEAAEAQAEPKDGSPEAPASPER-EEVALSEYKTETYDDYKDETTIDDSIMDADSLWVDTQDDDRSIM 1400
gi 672065475 1416 -----D-EELEVLMAAEAQAEPKDGSPDAPATPEK-EEVPFSEYKTETYDDYKDETTIDDSIMDADSLWVDTQDDDRSIL 1488
gi 884928300 1408 -----EeEELEEEVAAEAQAEPKDGSPEAPASPER--EAALSEYKTETYDDYKDETTIDDSVMDADSLWVDTQDDDRSIM 1480
gi 620945528 1310 eeeeeA-SEPEAEELMDDRPEPKEGSPEAPASPDKeEEVGLSEYKTETLDDYRDETTIDDSIMDADSLWVDTQDDDRSIM 1388
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 215274255 1401 TEQLETIPKEEKAEKEARRSSLEKHRKEKPFKTGRGRISTPERKVAKKEPSTVSRDEVRRKKAVYKKAELAKKTEVQAHS 1480
gi 672065475 1489 TEQLETIPKEERAEKEARRPSLEKHRKEKPFKTGRGRISTPERKVAKKEPSTVSRDEVRRKKAVYKKAELAKKSEVQAHS 1568
gi 884928300 1481 TEQLETIPKEEKADKEARRPSLEKHRKEKPFKTGRGRISTPERKIAKKEPSTVSRDEVRRKKAVYKKAELAKKTEVQAHS 1560
gi 620945528 1389 TEQLETVPKEEKSEKEARRPSLDKHRKEKPFKAGRGRISTPERKIAKKEPSTVSRDEVRKKK-VYKKAELAKKTEVQAHS 1467
                        1210      1220
                  ....*....|....*....|....*
gi 215274255 1481 PSRKFILKPAIKYTRPTHLSCVKRK 1505
gi 672065475 1569 PSRKLILKPAIKYTRPTHLSCVKRK 1593
gi 884928300 1561 PSRKFILKPAIKYTRPTHLSCVKRK 1585
gi 620945528 1468 PSRKFILKPAIKYTRPTHLSCVKRK 1492
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap