Conserved Protein Domain Family
BRX

?
pfam08381: BRX 
Transcription factor regulating root and shoot growth via Pin3
The BREVIS RADIX (BRX) domain was characterized as being a transcription factor in plants regulating the extent of cell proliferation and elongation in the growth zone of the root. BRX is rate limiting for auxin-responsive gene-expression by mediating cross-talk with the brassino-steroid pathway. BRX has a ubiquitous, although quantitatively variable role in modulating the growth rate in both the root and the shoot. The family features a short region of alpha-helix, approximately 60 residues in length, which is found repeated up to three times. BRX is expressed in the vasculature and is rate-limiting for transcriptional auxin action.
Statistics
?
PSSM-Id: 337032
View PSSM: pfam08381
Aligned: 63 rows
Threshold Bit Score: 69.9062
Threshold Setting Gi: 960485568
Created: 26-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 122205675   266 WREWVEEYEPGVFITVGAYPGHRLQLRCVELSREKFGEVKARVWWEENKARLHHLY 321
gi 1063723131  604 EKEKIEYCEPHVYITPAIFSDGTRAPKYVESSRRVTQVHHAKTWWPENCEKVYENH 659
gi 1063723133  723 DEKNFEYCEQGVYITLGILSGGIIVLKHLEFSRRM--AQQAKVWWSENWIKVYQEH 776
gi 475576079   935 vdGVIEQIERGVYVTLAVSPGGRKDIRRIRFSRKHFGEKAAQCWWEENKSRVYANY 990
gi 721697118   982 idgVIEQIERGVYATLAVSPSGQKDIRRMRFSRKHFSEKQAQRWWEENMSKVYEKY 1037
gi 566151461  1041 EAEWVEQDEPGVYITLTSLPGGIKDLKRVRFSRKRFSEKQAEQWWAENRARVYEKY 1096
gi 302822159   914 PEEWVEQDQAGVYITLALAPGGGRDLKRVRFSRRRFSEKEAEQWWQDNRVRVHQQY 969
gi 302796691  1021 ENDWVEQDQPGVYLTLCVLPAGGRELKRVRFSRKRFSEKQAEQWWQENRQRVHEQY 1076
gi 586766779  1058 lsEWVEQDEPGVYITLRSLPSGQKELKRVRFSRKKFTEKEAERWWSENRSRVHRKY 1113
gi 769799381  1003 AQERVVQDEPGVYITLTSLPSGAVDLKRVRFSRKRFTEKEAELWWAENRARVYKQY 1058
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap