Conserved Protein Domain Family
BRX

?
pfam08381: BRX 
Transcription factor regulating root and shoot growth via Pin3
The BREVIS RADIX (BRX) domain was characterized as being a transcription factor in plants regulating the extent of cell proliferation and elongation in the growth zone of the root. BRX is rate limiting for auxin-responsive gene-expression by mediating cross-talk with the brassino-steroid pathway. BRX has a ubiquitous, although quantitatively variable role in modulating the growth rate in both the root and the shoot. The family features a short region of alpha-helix, approximately 60 residues in length, which is found repeated up to three times. BRX is expressed in the vasculature and is rate-limiting for transcriptional auxin action.
Statistics
?
PSSM-Id: 312028
View PSSM: pfam08381
Aligned: 64 rows
Threshold Bit Score: 62.962
Threshold Setting Gi: 0
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 122205675  266 WREWVEEYEPGVFITVGAYPGH-RLQLRCVELSREKFGE-VKARVWWEENKARLHHLY 321
3_pfamImport    1 -TEWFSQVELGVFITFVTLPNG-CNALKRIRFSRDIFSK-KEAESWWAENGNRVREVY 55
18_pfamImport   1 SQEWVAQVEPGVLITFIAMPNG-ENELKRIRFSRELFNK-WQAEAWWAENCERVHELY 56
42_pfamImport   1 EKEWVAEPESGVLITLVSLPDG-GNNIKKIRFSQKMFDD-LGAQRWWSENYDKIMELY 56
34_pfamImport   1 DHEWVAEPEPGVLMTLVARPDG-TNHLRRIRFSEELFDGhRAAQRWWADNYDSIVELY 57
26_pfamImport   1 GREWVAEPEPGVSMTLAARRDG-TNRLRRVRFRAELFDA-WAARAWWADNCDRIFELY 56
gi 122205675  108 EREWVAEPEPGVLLTLAPRADGvSNRLRRIRFREEVFDA-WAAQCWWADNHDRIAELY 164
36_pfamImport   1 DREWAAEPEPGVLMTLVSRGDG-TNHLRRIRFSEDYFGDaWAAQSWWADNCDRIVELY 57
4_pfamImport    1 KAEWI-HLALGVSILLNIRSDG-TTILKHLSYNRSM--A-QQAKIWWYENLERVCKKY 53
5_pfamImport    1 DEKNFEYCEQGVYITLGILSGG-IIVLKHLEFSRRM--A-QQAKVWWSENWIKVYQEH 54
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap