Conserved Protein Domain Family
Gly_acyl_tr_C

?
pfam08444: Gly_acyl_tr_C 
Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region
This family features the C-terminal region of several mammalian specific aralkyl acyl-CoA:amino acid N-acyltransferase (glycine N-acyltransferase) proteins EC:2.3.1.13.
Statistics
?
PSSM-Id: 117021
View PSSM: pfam08444
Aligned: 8 rows
Threshold Bit Score: 166.468
Threshold Setting Gi: 74731045
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75042675  207 CCLLGPEGTPVCWDLMDQTGEMRMAGTLPEYRLHGLVTYVIYSHAQKLGKLGFPVYSHVDYSNEAMQKMSYTLQHVPIPR 286
gi 81883270  207 SCVLGPEGTPASWTLMDQTGEMRMGGTVPQYRAQGLVSFVIYSQDQIMKKRGFPVYSHTDKSNTVMQKMSYSLQHLPMPC 286
gi 74730653  202 FGVLGPEGQLVSWIVMEQSCELRMGYTVPKYRHQGNMLQIGYHLEKYLSQKEIPFYFHVADNNEKSLQALNNLGFKICPC 281
gi 74731045  208 ACMLGPEGVPVSWVTMDPSCEVGMAYSMEKYRRTGNMARVMVRYMKYLRQKNIPFYISVLEENEDSRRFVGQFGFFEASC 287
gi 81881830  206 FCIMGPEGTPVSWTLMDHTGELRMGGTLPKYRRQSLIYHVASQQIQTLEKLGFPMYAHVDKANFTVQRMVGLLGQILLPC 285
gi 143343351 206 VCIMGPEGTPVSWALMDHTGELRMAGTLPKYRHQNLIYHVAFHQVHTLEKLGFPMYLHVDKVNLTIQRMSAVLGHVPMPC 285
gi 143019008 206 FCLLGPEGTPASWSLMDQTGEIRMGATLPEYRGHGLISHMLAVHTRALDQLGIPVYNHTDKANKIVQKVSHNLHHIAIPH 285
gi 143019086 206 FCLLGTEGTPVSWSLMDQTGEMRMAGTLPEYRAQGLVTHAIYQQAQCLLKRGFPVYSHVDPKNQIMQKMSQSLNHVPMPS 285

                 ....*....
gi 75042675  287 SWNQWNCVP 295
gi 81883270  287 AWNQWICVP 295
gi 74730653  282 GWHQWKCTP 290
gi 74731045  288 EWHQWTCYP 296
gi 81881830  286 TWNQWNCVP 294
gi 143343351 286 TWNQWNWVP 294
gi 143019008 286 GWNQWNCEP 294
gi 143019086 286 DWNQWNCEP 294
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap