Conserved Protein Domain Family
FR47

?
pfam08445: FR47 
Click on image for an interactive view with Cn3D
FR47-like protein
The members of this family are similar to the C-terminal region of the D. melanogaster hypothetical protein FR47. This protein has been found to consist of two N-acyltransferase-like domains swapped with the C-terminal strands.
Statistics
?
PSSM-Id: 117022
View PSSM: pfam08445
Aligned: 9 rows
Threshold Bit Score: 92.0074
Threshold Setting Gi: 47169190
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1SQH_A      211 SLGICRS--DTGELIAWIFQNDF-SGLGXLQVLPKAERRGLGGLLAAAXSREIARgEEITLTAWIVATNWRSEALLKRIG 287
gi 74870492 196 GLGIFRK--ETGELAAWMVHSYY-GAMFSMQTRPDFRRMGYGIRLAKSLTQLVIE-RGYTPFVVIRPGNDASRSLYTKLG 271
gi 74572813 146 VYGLFLGnrLVSAAYTWIETRDV-GIIGGVLTREEFRNRGFASSVVSQLTEDIVK-RGKIASLYVREDNTPAIHVYKKIG 223
gi 81721059 198 YLGIRRGg-ALVAMAGERLHPPGwTEISAVCTDPEFRGEGLAGRLVLAVAHGIRE-RGETPFLHTGAGNTNAIRLYEALG 275
gi 81716176 145 YLGIRHRg-RLIAMAGERLRPPGwTEISAVCTHPDHRGRGLATRLVRAVAAGIRE-RGDTPFLHAAASNTTAIRLYESIG 222
gi 74869799 179 NLGAYD---DKGKLVAWCLRLPI-GSLGLLQVLESHKRLGLGSLLVKSMAKKISA-AGDQVLAPVVTKNTPSRSMFEKLG 253
gi 74869388 187 SVGLYQE--DTQELVAWCIRLQG-GYLGALQVKDTHKRRGFGSVVTREIAYRLAV-QGHDVMALVGPSNKPSSEMFSKLG 262
gi 74869390 189 NVGLYEK--ELGSLCAWCLRLQS-GFLGALEVLPTHQRRGLGLVVAAAISKAIATdLQQDITALVNINNSAACRVFEKLN 265
gi 81347795  66 VVGFVSG--GPNRAADGLIAKYD-GELYAIYLLKEVQGKGLGRQLVQALIRHLAQ-KGIHSLVVWVLADNPSRGFYERLG 141
                        90
                ....*....|..
1SQH_A      288 YQKD--LVNEWI 297
gi 74870492 272 YEKA--FETCRV 281
gi 74572813 224 FIEY--WKRLWV 233
gi 81721059 276 FRLR--RTTRFL 285
gi 81716176 223 FTLRraTESVRV 234
gi 74869799 254 FRAI--DNTYWA 263
gi 74869388 263 FQVI--DQCYWL 272
gi 74869390 266 FRLIqdEHYYWS 277
gi 81347795 142 GEKL---AEERV 150
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap