Conserved Protein Domain Family
Carmo_coat_C

?
pfam08462: Carmo_coat_C 
Click on image for an interactive view with Cn3D
Carmovirus coat protein
This domain is found to the C-terminus of the pfam00729 domain in Carmoviruses.
Statistics
?
PSSM-Id: 117039
View PSSM: pfam08462
Aligned: 8 rows
Threshold Bit Score: 198.405
Threshold Setting Gi: 81948920
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1OPO_B       250 QASNDKVSDGPTYVVPSVNGNELQLRVVAAGKWCIIVRGTVEGGFTKPTLIGPGISGDVDYESARPIAVCELVTQMEGQI 329
gi 81966663  250 QASNDKVSDGPTYVVPSVNGNELQLRVVAAGKWCIIVRGTVEGGFTKPTLIGPGISGDVDYESARPIAICVLVTQMEGQI 329
gi 81934344  250 QASNDKVSDGPTYVVPSVNGNELQLRVVAAGKWCIIVRGTVEGGFTKPTLVGPGISGDVDYESARPIAICELVTQMEGQI 329
gi 123855634 250 QASNDKVSDGPTYVVPSVNGNELQLRVVAAGKWCIIVRGTIEGGFTKPTLIGPGISGDVDYESARPIAICELVTQMEGQI 329
gi 81948920  250 QASNDKVSDGPTYVVPSVNGNELQLRVVAAGKWCIIVRGTVEGGFTKPTLVGPGISGDVDYESARPIAICELVTQMEGQI 329
gi 81976509  250 QASNDKVSDGPTYVVPSVNGNELQLRVVAAGKWCIIVRGTVEGGFTKPTLIGPGISGDVDYESARPIAICELVTQMEGQM 329
gi 81966665  250 QASNDKVSDGPTYVVPSVNGNELRLRVVAAGKWCIIVRGTVEGGFTKPTLVGPGISGNVDYESARPIAICELVTQMEGQM 329
gi 75560523  250 QASNDKVSDGPTYVVPSVNGNELQLRVVAAGRWCIIVRGTVEGGFTKPTLIGPGISGDVDYESARPIAICELVTQMEGQI 329
                         90
                 ....*....|....*....
1OPO_B       330 LKITKTSAEQPLQWVVYRM 348
gi 81966663  330 LKITKTSAGQPLQWVVYRM 348
gi 81934344  330 LKITKTTAEQPLQWVVYRM 348
gi 123855634 330 LKITKTAAEQPLQWVVYRM 348
gi 81948920  330 LKIAKTSAEQPLQVVVYRM 348
gi 81976509  330 LKITKTSAEQPLKVVVYRM 348
gi 81966665  330 LHITKTSAEQPLQWVVYRM 348
gi 75560523  330 LNITKTSAEQPLQWVVYRM 348
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap