Conserved Protein Domain Family
ox_reductase_C

?
pfam08635: ox_reductase_C 
Putative oxidoreductase C terminal
This is the C terminal of a family of putative oxidoreductases.
Statistics
?
PSSM-Id: 117208
View PSSM: pfam08635
Aligned: 6 rows
Threshold Bit Score: 279.381
Threshold Setting Gi: 380865443
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74681910  231 RYSAAVQKMKQILKENNLEVMMTSARYVMAYEHSAKIAWWTKSVDCGPIVEQATHFCDLSRYFAGEVDLDTVMAHSIEWY 310
gi 380865443 190 RYLKTVQKAKEIIKEKNLKVVSTVAKYNSAYIHNSKKFWWIMSESGGPVVEQGTHFCDLSRYFGGDVEIDSIKVNRVEWD 269
gi 1175421   169 RYLKIVQAAKKYVADNNLNIACTIARYNSAYEHNNKLFWWYMSKSGGPVVEQATHFCDLSIYFGGDVDTSTVKVNRVNWY 248
gi 74686354  218 RYLNAVREMKKIIDDNNLTVMATNARYVTAYELAIKTDWWNKSIMQGPIIEQGTHICDLSRYFGGDVNIETICAHALEAH 297
gi 74686999  252 RYLQCVQKMKQIIHENNLTVMATNARYSCAYEAIAKPAWWNKAIDMGPVIEQGTHFCDLSRYFGGDVDMNSIASRSVEWY 331
gi 758974271 241 RYLKVVQKMKQILDENNLKVMATNARYVMAYEHTNKPDWWDKSISCGPIVEQATHFCDLSRYFGGEVDLATVSAHSLEWF 320
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 74681910  311 EKPGQLTKIPFDESAlVPEDDRIPRFTSATWKYKSGAIGHLEHGVSLQGTQFSTEITVFADGY 373
gi 380865443 270 DPSGKLNAMPVDEKT-IPPEERIPRFTAASWKYKDGGVGAFTHNITLQGAKYDTCIEVQADGY 331
gi 1175421   249 DPCGKLAKVPVDEES-IPKEERIPRFTAASWKYKSGAVGILAHSIILQGTNYDTCLELQADGH 310
gi 74686354  298 EKPGRLSKLNFDESV-IPDNLRIPRATSASWKYESGAVGTMLHATALHGKDYAIELEVYADGF 359
gi 74686999  332 EEPGKLSKIPIDESK-IDEDLRVPRLTSAIWKYENGAVGSFQHAVALQGTAYSCELEVWADGY 393
gi 758974271 321 EPAGQLSKIPIDESK-IAEDQRIPRITCANWKYESGAVGSLTHAVSLQGFNYSTELDVLADGY 382
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap