Conserved Protein Domain Family
Hema_stalk

?
pfam08720: Hema_stalk 
Click on image for an interactive view with Cn3D
Influenza C hemagglutinin stalk
This domain corresponds to the stalk segment of hemagglutinin in influenza C virus. It forms a coiled coil structure.
Statistics
?
PSSM-Id: 72144
View PSSM: pfam08720
Aligned: 3 rows
Threshold Bit Score: 324.68
Threshold Setting Gi: 7245543
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1FLC_B         1 IFGIDDLIIGVLFVAIVETGIGGYLLGSRKESGGGVTKESAEKGFEKIGNDIQILKSSINIAIEKLNDRISHDEQAIRDL 80
gi 119364590 447 IFGIDDLIIGLLFVAIVEAGIGGYLLGSRKVSGGGVTKESAEKGFEKIGNDIQILRSSTNIAIEKLNDRISHDEQAIRDL 526
gi 119364590 447 IFGIDDLIIGLLFVAIVEAGIGGYLLGSRKVSGGGVTKESAEKGFEKIGNDIQILRSSTNIAIEKLNDRISHDEQAIRDL 526
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1FLC_B        81 TLEIENARSEALLGELGIIRALLVGNISIGLQESLWELASEITNRAGDLAVEVSPGCWIIDNNICDQSCQNFIFKFNETA 160
gi 119364590 527 TLEIENARSEALLGELGIIRALLVGNISIGLQESLWELASEITNRAGDLAVEVSPGCWVIDNNICDQSCQNFIFKFNETA 606
gi 119364590 527 TLEIENARSEALLGELGIIRALLVGNISIGLQESLWELASEITNRAGDLAVEVSPGCWVIDNNICDQSCQNFIFKFNETA 606
                        170
                 ....*....|....*
1FLC_B       161 PVPTIPPLDTKIDLQ 175
gi 119364590 607 PVPTIPPLDTKIDLQ 621
gi 119364590 607 PVPTIPPLDTKIDLQ 621
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap