Conserved Protein Domain Family
Gag_p15

?
pfam08723: Gag_p15 
Click on image for an interactive view with Cn3D
Gag protein p15
Gag p15 is a viral membrane-binding matrix protein which is alpha helical in structure.
Statistics
?
PSSM-Id: 72147
View PSSM: pfam08723
Aligned: 3 rows
Threshold Bit Score: 188.105
Threshold Setting Gi: 17942901
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1HEK_A        9 GDPLTWSKALKKLEKVTVQGSQKLTTGNCNWALSLVDLFHDTNFVKEKDWQLRDVIPLLEDVTQTLSGQEREAFERTWWA 88
gi 75621472   2 GDSLTWSKALKKLEKVTVQGSQKLTTGNCNWALSLVDLYHDTSFVKEKDWQLKDIIPLLDDVVQSLSGQEKEAFEKTWWA 81
gi 75621442   2 GDPLTWSKALKKLEKVTVQGSQKLTTGNCNWALSLVDLFHDTNFVKEKDWQLRDVIPLLEDVTQTLSGQEREAFERTWWA 81
                        90       100       110       120
                ....*....|....*....|....*....|....*....|...
1HEK_A       89 ISAVKXGLQINNVVDGKASFQLLRAKYekktaNKKQSEPSEEY 131
gi 75621472  82 ITAVKMGLQINNVGDGKASYQLLRAKH-----SKKQAEAPEAY 119
gi 75621442  82 ISAVKMGLQINNVVDGKASFQLLRAKYekktaNKKQSEPSEEY 124
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap