Conserved Protein Domain Family
DMPK_coil

?
pfam08826: DMPK_coil 
Click on image for an interactive view with Cn3D
DMPK coiled coil domain like
This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure. It plays a role in dimerisation.
Statistics
?
PSSM-Id: 117396
View PSSM: pfam08826
Aligned: 7 rows
Threshold Bit Score: 57.1565
Threshold Setting Gi: 83753541
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
1WT6_A         14 ELQEALEEEVLTRQSLSREMEAIRTDNQNFASQLREAEARNRDLEAHVRQLQERMEL-LQAE 74
gi 1706451    472 QLQEALEEEVLTRQSLSRELEAIRTANQNFSSQLQEAEVRNRDLEAHVRQLQERMEM-LQAP 532
gi 82232920   875 ELQSALEAEIRAKQLVHDELRKVKAANISFESKLKDTEAKNRELEEQLENMKKEMEE-SRSR 935
gi 290457650  744 ELQSALEAEIRAKQGLQERLTQVQEAQLQAERRLQEAEKQSQALQQELAMLREEL----RAR 801
gi 81174934   881 ELQSALDAEIRAKQAIQEELNKVKASNIITECKLKDSEKKNLELLSEIEQLIKDTEE-LRSE 941
gi 47222704  1025 ELQSALDAEIRAKQSIQDELNKVKAGNIATECKLQDTESKNQELLAEIDRLKKEMEE-LRLR 1085
gi 81174936   878 ELQSALEAEIRAKQLVHEELRKVKDTSLAFESKLKESEAKNRELLEEMQSLKKRMEEkFRAD 939
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap