Conserved Protein Domain Family
Transglut_prok

?
pfam09017: Transglut_prok 
Microbial transglutaminase
Microbial transglutaminase (MTG) catalyzes an acyl transfer reaction by means of a Cys-Asp diad mechanism, in which the gamma-carboxyamide groups of peptide-bound glutamine residues act as the acyl donors. The MTG molecule forms a single, compact domain belonging to the alpha+beta folding class, containing 11 alpha-helices and 8 beta-strands. The alpha-helices and the beta-strands are concentrated mainly at the amino and carboxyl ends of the polypeptide, respectively. These secondary structures are arranged so that a beta-sheet is surrounded by alpha-helices, which are clustered into three regions.
Statistics
?
PSSM-Id: 117583
View PSSM: pfam09017
Aligned: 4 rows
Threshold Bit Score: 836.603
Threshold Setting Gi: 75391930
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75369499   1 MYKRRSLLAFATVGALICTAGVMPSVSHA----ASGGDGEWEGSYAETHDLTAEDVKNINALNKRALTAGQPGNSPAELS 76
gi 38258605   1 MHKRRRLLAFATVGAVICTAGFTPSVSQA----ASSGDGEEKGSYAETHGLTADDVESINALNERALTLGQPGKPPKELP 76
gi 75370649   1 MRIRRRALVFATMSAVLCTAGFMPSAGEAa---ADNGAGEETKFYAETYRLTADDVANINALNESAPAASSAG------- 70
gi 75391930   1 MSQRGRTLVFAALGAVMCTTALMPSAGAAtgsgSGSGTGEEKRSYAETHRLTADDVDDINALNESAPAASSAG------- 73
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75369499  77 PSasalFRAPDAV--DDRVTPPAEPLNRMPDAYRAYGGRATTVVNNYIRKWQQVYSQRGGNPQQMTEEQREQLSYGCVGV 154
gi 38258605  77 PS----ASAPSRApsDDRETPPAEPLDRMPEAYRAYGGRATTVVNNYIRKWQQVYSHRDGKKQQMTEEQREKLSYGCVGV 152
gi 75370649  71 PS----FRAPDS---DDRVTPPAEPLDRMPDPYRPSYGRAETVVNNYIRKWQQVYSHRDGRKQQMTEEQREWLSYGCVGV 143
gi 75391930  74 PS----FRAPDS---DERVTPPAEPLDRMPDPYRPSYGRAETIVNNYIRKWQQVYSHRDGRKQQMTEEQREWLSYGCVGV 146
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75369499 155 TWVNTGPYPTNKLAFAFFDENKYKNDLENSRPRPNETQAEFEGRIAKDSFDEGKGFKRAREVASVMNKALDNAHDEETYI 234
gi 38258605 153 TWVNSGPYPTNRLAFASFDENKYKNDLKNTSPRPDETRAEFEGRIAKGSFDEGKGFKRARDVASVMNKALENAHDEGTYI 232
gi 75370649 144 TWVNSGQYPTNRLAFASFDEDRFKNELKNGRPRSGETRAEFEGRVAKESFDEEKGFQRAREVASFMNRALENAHAESAYL 223
gi 75391930 147 TWVNSGQYPTNRLAFAFFDEDKYKNELKNGRPRSGETRAEFEGRVAKDSFDEAKGFQRARDVASVMNKALENAHDEGAYL 226
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75369499 235 GHLKTELANKNDALLYEDSRSSFYSALRNTPSFKERDGGNYDPSKMKAVVYSKHFWSGQDQRGSSEKRKYGDPDAFRPGQ 314
gi 38258605 233 NNLKTELTNNNDALLREDSRSNFYSALRNTPSFKERDGGNYDPSKMKAVIYSKHFWSGQDQRGSSDKRKYGDPEAFRPDQ 312
gi 75370649 224 DNLKKELANGNDALRNEDARSPFYSALRNTPSFKERNGGNHDPSRMKAVIYSKHFWSGQDRSSSADKRKYGDPDAFRPAP 303
gi 75391930 227 DNLKKELANGNDALRNEDARSPFYSALRNTPSFKDRNGGNHDPSKMKAVIYSKHFWSGQDRSGSSDKRKYGDPEAFRPDR 306
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75369499 315 GTGLVDMSRDRNIPRSPAKPGESWVNFDYGWFGAQAEADADKTVWTHANHYHAPNGGMGPMNVYESKFRNWSAGYADFDR 394
gi 38258605 313 GTGLVDMSKDRSIPRSPAKPGEGWVNFDYGWFGAQTEADADKTTWTHGDHYHAPNSDLGPMHVHESKFRKWSAGYADFDR 392
gi 75370649 304 GTGLVDMSRDRNIPRSPTSPGEGFVNFGYGWFGAQTEADADKTVWTHGNHYHAPNGSLGAMHVYESKFRNWSEGYSDFDR 383
gi 75391930 307 GTGLVDMSRDRNIPRSPTSPGESFVNFDYGWFGAQTEADADKTVWTHGNHYHAPNGSLGAMHVYESKFRNWSDGYSDFDR 386
                       410       420
                ....*....|....*....|....
gi 75369499 395 GAYVITFIPKSWNTAPAEVKQGWP 418
gi 38258605 393 GAYVITFIPKSWNTAPAKVEQGWP 416
gi 75370649 384 GAYVITFIPKSWNTAPDKVKQGWP 407
gi 75391930 387 GAYVVTFVPKSWNTAPDKVTQGWP 410
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap