Conserved Protein Domain Family
CagZ

?
pfam09053: CagZ 
Click on image for an interactive view with Cn3D
CagZ
CagZ is a 23 kDa protein consisting of a single compact L-shaped domain, composed of seven alpha-helices that run antiparallel to each other. 70% of the residues are in alpha-helix conformation and no beta-sheet is present. CagZ is essential for the translocation of the pathogenic protein CagA into host cells.
Statistics
?
PSSM-Id: 72471
View PSSM: pfam09053
Aligned: 3 rows
Threshold Bit Score: 342.817
Threshold Setting Gi: 81341308
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1S2X_A        9 ELGFNEAERQKILDSNSSLXRNANEVRDKFIQNYATSLKDSNDPQDFLRRVQELRINXQKNFISFDAYYNYLNNLVLASY 88
gi 81341308   2 ELGFNEAERQKILDSNSSLMGNANEVRDKFIQNYASSLKDSNDPQDFLRRVQELRINMQKNFISFDVYYNYLNNLVLASY 81
gi 81341308   2 ELGFNEAERQKILDSNSSLMGNANEVRDKFIQNYASSLKDSNDPQDFLRRVQELRINMQKNFISFDVYYNYLNNLVLASY 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1S2X_A       89 NRCKQEKTFAESTIKNELTLGEFVAEISDNFNNFTCDEVARISDLVASYLPREYLPPFIDGNXXGVAFQILGIDDFGKKL 168
gi 81341308  82 NRCKQEKTFAESTIKNELTLGEFVAEISDNFNNFMCDEVARISDLVASYLPREYLPPFIDGNMMGVAFQILGIDDFGRKL 161
gi 81341308  82 NRCKQEKTFAESTIKNELTLGEFVAEISDNFNNFMCDEVARISDLVASYLPREYLPPFIDGNMMGVAFQILGIDDFGRKL 161
                       170       180       190
                ....*....|....*....|....*....|....*...
1S2X_A      169 NEIVQDIGTKYIILSKNKTYLTSLERAKLITQLKLNLE 206
gi 81341308 162 NEIVQDIGTKYIILSKNKTYLTSLERAKLITQLKLNLE 199
gi 81341308 162 NEIVQDIGTKYIILSKNKTYLTSLERAKLITQLKLNLE 199
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap