Conserved Protein Domain Family
DUF1923

?
pfam09083: DUF1923 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF1923)
Members of this family are found in maltosyltransferases, and adopt a secondary structure consisting of eight antiparallel beta-strands, which form an open-sided 'jelly roll' Greek key beta-barrel. Their exact function is, as yet, unknown.
Statistics
?
PSSM-Id: 72501
View PSSM: pfam09083
Aligned: 3 rows
Threshold Bit Score: 141.016
Threshold Setting Gi: 15988485
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....
1GJU_A      573 GKFENLTTKDLVMYSYEKNGQKIVIAANVGKEPKEITGGRVWNGKWSDEEKVVLKPLEFALVVQ 636
gi 81625270 575 GKFENLTTKDLVMYSYEKNGQKIVIAANVGKEPKEITGGRVWNGKWSDEEKVVLKPLEFALVVQ 638
gi 81625270 575 GKFENLTTKDLVMYSYEKNGQKIVIAANVGKEPKEITGGRVWNGKWSDEEKVVLKPLEFALVVQ 638
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap