Conserved Protein Domain Family
T4-Gluco-transf

?
pfam09198: T4-Gluco-transf 
Click on image for an interactive view with Cn3D
Bacteriophage T4 beta-glucosyltransferase
Members of this family are DNA-modifying enzymes encoded by bacteriophage T4 that transfer glucose from uridine diphosphoglucose to 5-hydroxymethyl cytosine bases of phage T4 DNA.
Statistics
?
PSSM-Id: 72614
View PSSM: pfam09198
Aligned: 2 rows
Threshold Bit Score: 76.5842
Threshold Setting Gi: 34810435
Created: 23-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                   10        20        30
           ....*....|....*....|....*....|....*...
1J39_A   1 MKIAIINMGNNVINFKTVPSSETIYLFKVISEMGLNVD 38
1J39_A   1 MKIAIINMGNNVINFKTVPSSETIYLFKVISEMGLNVD 38
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap