Conserved Protein Domain Family
DBD_Tnp_Hermes

?
pfam10683: DBD_Tnp_Hermes 
Click on image for an interactive view with Cn3D
Hermes transposase DNA-binding domain
This domain confers specific DNA-binding on Hermes transposase.
Statistics
?
PSSM-Id: 119203
View PSSM: pfam10683
Aligned: 4 rows
Threshold Bit Score: 127.67
Threshold Setting Gi: 74875269
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
2BW3_A        4 QSRELKTVSADCKKEAIEKCAQWVVRDCRPFSAVSGSGFIDXIKFFIKVKAEYGEHVNVEELLPSPIT 71
gi 74875269 254 RPTELKIVSEIDREEAIEKCTQWVVQDRQSFSAVTGAGFKNLVQFFLKIGAVYGDQVDVDDLLPDPTT 321
gi 74819291 127 RPSELIIVSENDKKVAIEKCTQWVVRDCPPFSAVTGAGFKKKVKFFLQIGAIYGEQVDVDDLLPDPPT 194
gi 74894014  78 TSQELRTVTVEDKNEAVKKFTSWVVEDCRPFSVVQGSGFIKLVKFFIKIGASYGEHVDVEDLLPSATT 145
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap