2JD3


Conserved Protein Domain Family
Plasmid_stab_B

?
pfam10784: Plasmid_stab_B 
Click on image for an interactive view with Cn3D
Plasmid stability protein
This family is conserved in the Enterobacteriales. It is a putative plasmid stability protein in that it is expressed from the operon involved in stability, but its actual function has not yet been characterized.
Statistics
?
PSSM-Id: 119304
View PSSM: pfam10784
Aligned: 12 rows
Threshold Bit Score: 78.9234
Threshold Setting Gi: 363642981
Created: 28-Mar-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
2JD3_A          8 KKYTLYLHPEK-AADFQTLEAIESVPRSERGELFRNAFISGMALHQLDPRLPVLLTAILSEEFSADQVVTLL 78
gi 983412612    5 RKCSFYIYPERnAADRVADGFLEKLPQKERGRAMRAMMLCGAALMKQDERLPFLIAEFLTESTSMQDIQRII 76
gi 208645       6 RTIAFKLNPDVnQTDKIVCDTLDSIPQGERSRLNRAALTAGLALYRQDPRTPFLLCELLTKETTFSDIVNIL 77
gi 647216482    8 RRCSFELFPDErTGDKIADELIANEKLKERGRFMRAMLVTGAAFAAIDKRLPLLISELLTENTTLDDINKVI 79
gi 378021802    8 KKFTLYLHPEK-AADFQTLEAIESVPRSERGELFRNAFISGMALHQLDPRLPVLLTAILSEEFSADQVVTLL 78
gi 499198302   10 RKFTSYLQLDC-EADRRALDVVESISQRVRGDFLRNAIITTAALHQLDPRLPVLLATLYNGQLTSEQLVNLV 80
gi 1048232319   4 GQYSFYLHSDD-RTDIAAMATISTISQPLRGEFIRTAATAGAVVYQVDARLPALIPVFFAGQLSAVRLCAVM 74
gi 920479127    8 KKLSLYLHPED-SADCLALAEIETVPRKKRGELYRQALITGLIMHQLDERIPAVLTALFTRELNADEVISQI 78
gi 545230869    6 RRISFYLKPAAvKNEGKACAWLDSLTPEARKSGQRVAFLAGLALMKINPAEAYRLAAWADDEALSLTQTRTE 77
gi 446133425    6 RRISFYLKPAAvKSEQEACNYLDSLPASERSRAQRAAFLAGLALIKRNPAFAYWMAEWPEDNLPFNTVSIKE 77
gi 363642981    1 RRYTLTLQNG--RSGERVESVLTEASSRLRGDLLRNLIITGLALHTTAPELPRLLASMPVPPTSVSELQALV 70
gi 446368074   10 KKVVAYLHPALyPQDNLTQQTIDSLPVQMRGDFYRQSLICGAALYSVAPRLLTLISVFFSEKITAENLVKLI 81
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap