Conserved Protein Domain Family
DUF4558

?
pfam15104: DUF4558 
Domain of unknown function (DUF4558)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 78 and 121 amino acids in length. One member is annotated as being a flagellar associated protein.
Statistics
?
PSSM-Id: 317516
View PSSM: pfam15104
Aligned: 16 rows
Threshold Bit Score: 82.3756
Threshold Setting Gi: 780105575
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124465158  13 QYTEAERYDQNLKSISR--------------------NTWWHESKSKYDKVNEL-KFMNKVY--------SKEVENAYQE 63
gi 395532031  30 RIVAFEKAVESWKNAVM--------------------RCLWQETMTQRRNPYAI-LNMRNIM--------EQEMVLANQQ 80
gi 565302628  22 KFKEFSKFLQSWKRDQA--------------------MCLELKSQEDRCFARSR-KRHQTEM--------KEEMHYANKQ 72
gi 156364518  35 WNSERESTVKEDIKVNL--------------------IADWSEKLEETSQRRNV-KRWHDET--------KSELSLANQE 85
gi 255077391  14 RLARNSAIVTGMMKTQQ--------------------VSDWHERQYHRTGGPTVgERQADEA--------ELELQMANAS 65
gi 260794557  31 MYASRQSTVRHEKEVNL--------------------VSEWSEGLEEASEARRY-KDDLKKM--------KEEVRLANRA 81
gi 146182628  13 KYQQAEQYSKKLEGISR--------------------ITNWHETKVKYDNANQN-KYARKMI--------DQEMKYALKE 63
gi 159466336  17 MYARLQKQNKEELRTAI--------------------IAQWTERDLQRPPPSTG-LTKASITlagtssdrDAGIKSGVQT 75
gi 821481032  17 riVAFEKAVESWKNAVM--------------------RCLWQETMTQRRNPYAI-LNMRNIM--------EQEMVLANQQ 67
gi 780105575  14 enKSLQRALHRQKERIKydelmaaregivknellinqKAVWTEKLEEASAHRRL-KTEKSAV--------KGEIAIAGKT 84
                         90       100       110
                 ....*....|....*....|....*....|....*
gi 124465158  64 LKKRRNCMLKDLYEKEAREWEQELRAKGLAIYKNK 98
gi 395532031  81 LLTVRQAALSQLFEKEHRQYQQELNQMGKSFYVER 115
gi 565302628  73 LMMLRRAALKHLLSTEHLQYQLEFNHLGMSFYAER 107
gi 156364518  86 LAAVRRAQLRKLLMEEEAMYKCELNAQEKAFYIKR 120
gi 255077391  66 VHELRRAKMRELVARDDLRWETELNAMGLTVSKDR 100
gi 260794557  82 MVAVRRAALKKLIEEEHRAHEQELHAMGKAFYIKR 116
gi 146182628  64 VKMVRNVKLKELYEQEAKQWEQELSQKGLAIYKHK 98
gi 159466336  76 VKAARQARLRELFEREALMYEKELNARGLSLVKPR 110
gi 821481032  68 LLTVRQAALSQLFEKEHRQYQQELNQMGKSFYVER 102
gi 780105575  85 LIAVRRAALRQLIDQEYGQFEEELRAQGKAFYFKR 119
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap